Identifiers and Description

Gene Model Identifier

Contig19959.0.g30

Standard Name

CNOT9a

Aliases

Contig19959_0_g30

Description

Cell differentiation family, Rcd1-like

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam04078 ) Cell differentiation family, Rcd1-like
  • ( pfam09321 ) Domain of unknown function (DUF1978)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012225905.002059218654967e-104Cell differentiation family, R
cd1-like contai...
SGDYNL288W4.001158060863534e-95CAF40 SGDID:S000005232, Chr XI
V from 90303-91424, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19959.0.g30(coding)
ATGAATAATAGTGTGTCAACTGCGATATCTGGCAATTTCATGTCAAATTAAAAGTTCAGT
GAAGAAGAGAAGCAAGCAATAATTAAGCACATTGATGAATTAAAAATTTCAGAGAAAAGA
GACAATGCCTTGATCGAGCTAAGTCGCCAGAGAGAGCACTTCACTGAATTAGCGCCATTC
ATTTGGCACTCTGTTGGAACTATAGCTGCATTGCTTTAAGAGATTATAGCTGTTTACCCT
CAACTTTCTCCACCAAATCTCGATACTAAAACATCCAACAAAGCTTGTAACGTGTTAGCA
TTACTCTAATGCGTGGCTTCTCACAAAGAGACTAAGTAGTTGTTTTTACGGGCACATATA
CCACTTTTCTTATACCCTTTTCTCAACACTGTAAGTAAAGGGAGACCTTTTGAGTATTTG
AGATTGACTTCTCTTGGAGTAATTGGAGCGCTTGTGAAAATGGATGATCCAGAGGTAATC
AGTTTCTTACTTCAAACTGAGATTATTCCACTATGTTTGAGAATCATGGAGAGAGGTACC
GAGTTATCTTAAACTGTAGCAACTTTCATAATTCAAAAGATTCTCTTTGATGATTAAGGC
TTAAATTATCTCTGTTAAACAGCAGAGAGATTTTTCGCTGTAAGCACAGTTCTAAACAAT
ATGGTTAACTCTTAAATTGAAAAACCATCCTAGAGACTATTAAAGCATATCGTGAGATGC
TACAACAGACTATCTGAAAACATAAAAGCTAGAGTAGCTTTAAGAGAAAACATGCCAATT
ATCCTAAAAGAGAGCAAGATTTACGATAGTCTGGATGAGTCTACTAGAAAATGTTTGAAA
AATTTGAGCGATTAATTGTCAATGAATGAGAAAGTTGAAAACTCCTCTTTCCAACAGGAA
ATGACTCCTTAATCAACTATTGACTAGAGGCAATTGTAAATGACTTTCAGTAATTATGAA
ATGTTTAAGCAGCAACCTACACCCACAGCAGAGCAGCAATAGCAATCAATTCCACCTATT
ATCTTCCCTCAACAGCTTGCCAGTTTGCAAAATGCCTAAGTGTAAATTATCAGCAGACCT
TAGAGCAGTGCAAGTATTCAGATGCAACCTTAAGCCACACCATTTTAAAGAATGAACATG
GTTTCTCCCCCACCTTTCCAGTAGAACATCAATATCTAACAAGTTCAACAAGCCAAGATT
ATCCAGCCAATTCCTCAAAACTAAACTTAACAGTAGTTCCAAGCCTTTGCCATGTAACAA
CAGCAACAGCAGTACAGAGTGCAAGGTATGAACCAAAATATGAACTTTATCCCTTAGATG
CAATCACCTCACTAGCCACACTTACAAATGTAAAACTAAAACCCTTAATATCAACAATCA
TAATTCTATCAGCAATATGGAAACCAAAGTAACATGATGTATAATGTTAACAGATAAGTA
TAATAGTAAATGCCTAATATGCAAGGCATGAACCCTCAAAATAATAAATAATGA


>Contig19959.0.g30(protein)
MNNSVSTAISGNFMSNQKFSEEEKQAIIKHIDELKISEKRDNALIELSRQREHFTELAPF
IWHSVGTIAALLQEIIAVYPQLSPPNLDTKTSNKACNVLALLQCVASHKETKQLFLRAHI
PLFLYPFLNTVSKGRPFEYLRLTSLGVIGALVKMDDPEVISFLLQTEIIPLCLRIMERGT
ELSQTVATFIIQKILFDDQGLNYLCQTAERFFAVSTVLNNMVNSQIEKPSQRLLKHIVRC
YNRLSENIKARVALRENMPIILKESKIYDSLDESTRKCLKNLSDQLSMNEKVENSSFQQE
MTPQSTIDQRQLQMTFSNYEMFKQQPTPTAEQQQQSIPPIIFPQQLASLQNAQVQIISRP
QSSASIQMQPQATPFQRMNMVSPPPFQQNINIQQVQQAKIIQPIPQNQTQQQFQAFAMQQ
QQQQYRVQGMNQNMNFIPQMQSPHQPHLQMQNQNPQYQQSQFYQQYGNQSNMMYNVNRQV
QQQMPNMQGMNPQNNKQ