Identifiers and Description

Gene Model Identifier

Contig9023.0.g5

Standard Name

CNOT7d

Aliases

Contig9023_0_g5

Description

CAF1 family ribonuclease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004731501.000159011384939e-43CAF1 family ribonuclease conta
ining protein
SGDYNR052C1.9994920269952867e-34POP2 SGDID:S000005335, Chr XIV
from 720647-719346, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9023.0.g5(coding)
ATGTTTTCGGATAAGTTTTCACTATACCACCTTCCAAATTATGCTAAGCTTTAAGATGAA
AATTCATCACAGCATATAAGTCACTATCAAAGTATGAACCAATCGAATGATTGCTATTTC
AATACAGCCCCAGCCACTCCCACTTATTAGGACTTTCTTACTATGGGGAATACAAAAGAC
TGTCAACCTTAATACACAAGCCAAGAGTCAAACTATGGAGAGTTTATTGTTAGACAAACT
TTAAGTTAGTCCCCTCCTTCAGGATCAGAGCAAACTTACTAAGTGAAAGATGTTATTTCA
CCTATTAGAGATGTCTGGGTACATAACTTCTTTGATGAGTTGGCTATTCTTGCTTCTTAT
ATAGAATCAAGCTACAATATCATAGCATTTGATACTGAGTTTCCAGGCATACTGATTGAA
AAGAGTACCTTTTTCAAAGGAAAAACTCTTCAAAAACCTTTTTATTAATGGATTAAAGAG
AACGTAGATTCATCTAAAGTCATTTAGTTAGGAATTAGTATCTCAAATGAAGATGAAGAA
CAACCTTTTCCAGTATCAACTTGGCAATTTAACTTTTAATTCGATAAAAATCAAGATATC
TACAACTAGGAGTCGATTGAGTTGCTTGAAAATGCTGGACTTAACTTTTCTGATCATGAA
AGAAATGGGATACCTCACAATACTTTTGCTGAATATGCGTTTGGTTCAGGTCTACTTTTA
AACTCATCTTTAAAATGGGTTGCTTTCAACTCCGCCTTTGATTTTGGATACTTGCTCAAA
ATGTTCACACAGTTCCCACTTCCAAATACCGAAGAAGAGTTTCTCTAGCAGGTATAGCTA
TATTTCCCTGTTTACTACGATGTCAAACACTTGAGAAGTGATGGAAAGGATCTAAACTCA
CAGATAAGAAATGAATAAATCTATCGTGAAGGTGTTGCTCATCAGGCAGGTAGTGATAGT
TTAGTAACTCTGTAGCTTTATCATAAATCTATGAAAGATCCAATCTATAAGAAATAGAAT
CTTCAAATTAATGCTAAGAATGTGATATATAGGCTTGGGGATTTCTATAGAAGAGAGGAA
TCTAAGGATTAAAAGTTGTATTACCAGCAGAAACATAAACTTTTCAAAGAAGCTGGAAGA
AAAAGTGAGTTAGTTTAGAGTAGAAGACACATAGATGATTACGTTAAACCTGTTAAAGAA
TATAATAGGATGGTTGTGAATGATGACTAAAAGGTTGAAGAGAGTTAACATTTTTATGAT
TAACAGAGTAACATATTAGGAAGTTAGGATTTAATTAACAATTTTAACACAGGTTTGAAC
TTAGCAGCACCTGAGTTTCAGTCTAAATATGAGCAAGACTATTTTGCCAAAAAAGCTGTA
CAATAGTAGTAAATGCAGAAAAAGTCAGCTAGCTCAGAAAGCATATAGTTCAATCCATTA
CAGATTTAAAATCCTGTGATCTAGCTTCAGCCTTAATTGAAACAATCATACAGTGCTCCT
GTTTAGTAAATAGTCATTTAGCAATAACCTGGATAAAGAGGATATTTACAAAACAATCAC
AATACTTAATAACACGCATATTAATAGCTTTAGAAGTAGTTGAGTCACAACTACGGGAAC
TACTAAAAGGTTTATGGAATTTAGCCAACTAATTGGAATGTTGCTCTAAACAACCTGGCT
TTAAATCATAATTAAACTGTTCAAAAATAGCAGCATCAATAATTCCAGCAAATGCCATTA
AATTCGTAGTAAAATTATGTAAACTCTCAAGATCTTTATTCATTCTAAAATCAATCTAAT
ATTCCTCTTAATTATCAAGGATAAGGCCATATTCCTCTGATGTACTAAACTCTTCTCTAA
AATTAATAACAGTACATTCACAATCCAAATCAATGCATAAATTTCCTTGAGAATCAATAT
GTCCCTTAGAACTTTAATGATCCACGATAAATGATTATGTAATAGCATAATTAAATTCCT
CCATGCCTCAGCTTCAATCCTACTGCAAAGCCATTCAACCCCTAAAACAATTTAGTAATA
TCACCATCGGGTCATTTAGTTAGACAACAATTATACTCTATTTAAAATGCTCCACCAAAT
ACAATTTAAGATTAAACATCACAAACTGGTTGTATCAATCCATCAAATGCAATTTCATTG
CAACAGTTTAACTGTTAGGGACAATAAAATGCTTCACAAAATCTACTTATAAACCAAAAC
AATTCTACTCAGCTTTAACAGTAATAGATTCATTAAGTTCCAAATGTGTAACCTTAACAA
TCAATGCCAAGCAAAAATGGTTTATCTAGTCAGCCAACTATGATATGA


>Contig9023.0.g5(protein)
MFSDKFSLYHLPNYAKLQDENSSQHISHYQSMNQSNDCYFNTAPATPTYQDFLTMGNTKD
CQPQYTSQESNYGEFIVRQTLSQSPPSGSEQTYQVKDVISPIRDVWVHNFFDELAILASY
IESSYNIIAFDTEFPGILIEKSTFFKGKTLQKPFYQWIKENVDSSKVIQLGISISNEDEE
QPFPVSTWQFNFQFDKNQDIYNQESIELLENAGLNFSDHERNGIPHNTFAEYAFGSGLLL
NSSLKWVAFNSAFDFGYLLKMFTQFPLPNTEEEFLQQVQLYFPVYYDVKHLRSDGKDLNS
QIRNEQIYREGVAHQAGSDSLVTLQLYHKSMKDPIYKKQNLQINAKNVIYRLGDFYRREE
SKDQKLYYQQKHKLFKEAGRKSELVQSRRHIDDYVKPVKEYNRMVVNDDQKVEESQHFYD
QQSNILGSQDLINNFNTGLNLAAPEFQSKYEQDYFAKKAVQQQQMQKKSASSESIQFNPL
QIQNPVIQLQPQLKQSYSAPVQQIVIQQQPGQRGYLQNNHNTQQHAYQQLQKQLSHNYGN
YQKVYGIQPTNWNVALNNLALNHNQTVQKQQHQQFQQMPLNSQQNYVNSQDLYSFQNQSN
IPLNYQGQGHIPLMYQTLLQNQQQYIHNPNQCINFLENQYVPQNFNDPRQMIMQQHNQIP
PCLSFNPTAKPFNPQNNLVISPSGHLVRQQLYSIQNAPPNTIQDQTSQTGCINPSNAISL
QQFNCQGQQNASQNLLINQNNSTQLQQQQIHQVPNVQPQQSMPSKNGLSSQPTMI