Identifiers and Description

Gene Model Identifier

Contig1050.1.g16

Standard Name

CNOT7c

Aliases

Contig1050_1_g16

Description

CAF1 family ribonuclease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004553103.999458587140588e-43CAF1 family ribonuclease conta
ining protein
SGDYNR052C9.001422350855153e-28POP2 SGDID:S000005335, Chr XIV
from 720647-719346, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1050.1.g16(coding)
ATGTTGTCATAGGAAAGCTTTATAAATTACAACCCTACTGCGGTGGGATACGACTACTAT
TAAATGATGCCAGCTCAAAGCTAGTTCTAGCAAAGCTTAAACTTAGCTTCTCAATCTTAC
TCGCCCACGCTGGACTAGTAATAAAATGTTATGACTCACAATTACTATCAAAATGCTACT
ATTACTGTCAAGCAATCACAGATTTCAAACTTAGCTTAAACATCATCGTCATCATTTTTA
GGGACCAAAATGAATTAAGAAAGCAATCTCTAATTCAATCAATTTAACAATCACATACAA
CATTAAGAGTAGCCCTTAAAATCAAATGTCAAGGAGTTCATATACTAGCCCAAAATCATG
ATGCCGAATCTAAAATAAGATGCAAGCAAATTTGAAAATGATAAAACTTAAGAATCTGAG
AAAAAAGTTGTCAGAAGTGGGCCAATAATAAACATCAGCAGCTAAAAGAATTCAAATAAG
AACTTACAACCATTCAACACAACTCTTCTACAGTAATAGCTATCTGGCAGGATAGATATT
TAGGCAAAAAATGTTTTGTCTGGCACCGTAGTAGAAGTTTATCAAGATAACTTTTTCCAA
GAATTAGATCGCATAGCTTCCTTAGTTTAGATATATAACTTTATCGGCATGGATACAGAG
TTCCCAGGAGATGTATTCGATGGAAGCACCCAGTATTTGATGGTGAGAGAAAACGTTAAT
AATTTGAAATTAATTCAATTAGGCATTACTCTCAGTAATGAAGAGGGGGAGTATCCAGAA
CCTCACTGCACTTGGCAATTTAACTTCAAATTTGATTTAAAGAACGAAAAATGGAATGAA
AGCTCAATAAATTTATTGAAAAAATCTGGCATTAATTTTGAGGCTCTAGCTCTTAGAGGG
ATTAATCATGACACTTTCGCAGAGTACTTCATTTCTAGTGGCTTAATTATGAATAAGGAT
ATACATTGGTACGGCTTTCACACAGATCACGACTTCGCTTATCTTATGAGAATCTTATCA
GGAAACCTTTTGTCTCCCTCAGTTACTCAATTCTTATCAGATTTAACAATACTTTTCCCT
AACTTTTATGACATTAAGCAGATTGCTGATCAGGTTTACGGTTTCTTCAAGGGAAGTCTA
ACTGCTTTAAGTGAAAAACTAGGTGTAACAAGAGACGACAACTGCGAACATCAAGCTGGT
AGTGATTCAAAGATCACATCAAGGTGTTTCATTGAACTTCTCAAGTATTGCAAGAGCTAC
TTAGAAAGTTACTCTGGTGAAATTTATGGGATAAACAGTACCAGCGATAGCCATATTATG
AGCTTAAAGGAAAAAGCATAAGATCTAATTAAGCAATCTCATATTCAAAATCAGCTTGCG
TAGGAGAGCAACTTTATTTTCAGCAGCGACTTTGAGTAAATTTTGAATGAAAATATAGCA
GCAGAGCAGTTGAACATGGCTGATGATTGGAGCTAGTAATATGAGACCACTTATGTTTAA
GAGAATTAAAAATCAAGCAGCTTCTTGACAATGCATCCAGGCTTAGCAGCATAATTTAGC
AATAATTCAGCAAATTAAAACTATTAGGAAATGACTTTATTGGATCCATATCAGCAAGCC
CAAGATCAGAACTTACTATACTAGCAACAACTATAGAAGTACTAGAATGTTAAGTCATAT
TGCTACGATGAGACTGTTTATTCAGAGGGAGGCTATACAACCCCAACTACTTAAAACACT
CCATCTCCTTAGTTACATTCAATGTATGGATCCCCATAAAACCAGTACCAAACTATCCAA
CAAAGTAACAGCTTTAATAATTTGATCTCTCTAGTACAAGCTACTGGATCAAATTCACAG
ATTAATCAAAACTACTATCAAGGAAACTATCAAGCTTAAGAGTATAACAATGATTATCAG
AATTTTTATCAATATGAGAACAATAACATTAACTAGCAGCAGATGTATCAAAAACCCCAA
AACCCATAGATGTTGCCAACTAGCTTGTTCGATGTTTACAAAATGAATCAACAATGA


>Contig1050.1.g16(protein)
MLSQESFINYNPTAVGYDYYQMMPAQSQFQQSLNLASQSYSPTLDQQQNVMTHNYYQNAT
ITVKQSQISNLAQTSSSSFLGTKMNQESNLQFNQFNNHIQHQEQPLKSNVKEFIYQPKIM
MPNLKQDASKFENDKTQESEKKVVRSGPIINISSQKNSNKNLQPFNTTLLQQQLSGRIDI
QAKNVLSGTVVEVYQDNFFQELDRIASLVQIYNFIGMDTEFPGDVFDGSTQYLMVRENVN
NLKLIQLGITLSNEEGEYPEPHCTWQFNFKFDLKNEKWNESSINLLKKSGINFEALALRG
INHDTFAEYFISSGLIMNKDIHWYGFHTDHDFAYLMRILSGNLLSPSVTQFLSDLTILFP
NFYDIKQIADQVYGFFKGSLTALSEKLGVTRDDNCEHQAGSDSKITSRCFIELLKYCKSY
LESYSGEIYGINSTSDSHIMSLKEKAQDLIKQSHIQNQLAQESNFIFSSDFEQILNENIA
AEQLNMADDWSQQYETTYVQENQKSSSFLTMHPGLAAQFSNNSANQNYQEMTLLDPYQQA
QDQNLLYQQQLQKYQNVKSYCYDETVYSEGGYTTPTTQNTPSPQLHSMYGSPQNQYQTIQ
QSNSFNNLISLVQATGSNSQINQNYYQGNYQAQEYNNDYQNFYQYENNNINQQQMYQKPQ
NPQMLPTSLFDVYKMNQQ