Identifiers and Description

Gene Model Identifier

Contig22198.0.g120

Standard Name

CNOT7b

Aliases

Contig22198_0_g120

Description

CAF1 family ribonuclease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004553108.99586662241984e-56CAF1 family ribonuclease conta
ining protein
SGDYNR052C2.000704504372864e-47POP2 SGDID:S000005335, Chr XIV
from 720647-719346, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22198.0.g120(coding)
ATGGCAAGTAGTTCTGCTCAAGTGAAATTGAACAACACTCAATAGCAACCATCGCACTAG
CTGGCTTTCCAGCCTGTTTTCTCTCAGAGTGACCCCACTTTCGCTGCCTTTCAGGTGCCT
TCTATTCCCTACGACAGCATGCGGCTGCAGGACGAGCACATCAAGGACGTGTGGATTGAT
AATTTATTCACTGAATTGGACAACATCGCAAGACTCATTCAAACTTACAATTATGTTGCA
ATGGACACTGAGTACCCTGGCACTGTCTATCTTCCATCAGAAGTCAACAATGAATTTGAG
TATCAAATGGTGAAAGTAAACGTAGACAATTTGAAGTTGATTCAGGTAGGCATCACTCTC
TCTGATGCAAATGGCGCTGTTCCCATAGGTGTGTGTTCCTGGTAATTCAATCTGCATTAC
GATATAAGTTAAGAATTGTATGCGAAAGAGTCAATGGACTTACTGAAAAGATCAGGTTTT
GACTTTGACAAGCACAAGAGCAAGGGTATCCCACATGAGAAATTTGCAGAGTATTTAATT
ACAAGTGGACTCTTTTTGAATCCTGAAGTGCATTGGATCACTTTTCATGGAGGGGTAGAT
TTTGGATATATGCTCAAAGTTGTCCTAAATACAGAAATACCTAATGATGAAGCTAATTTC
TTTGAAATGATGAACATATATTTCTGCAATTTCTATGACATAAAGGAAATCAAAAGAGAT
ATAGATTATCTAACCGGAGGACTAAGTAAAATCGCAAAAGAGTTAGATATCGAACGAATC
GGAACTATGCATTAAGCAGGTAGTGATTCACTAGTCACTTGCAAGGTATTTTTCAAGCTA
AAAGAGCTATTCAAAAAGTGGTGGCCTAACGAGGATAGTCCTTCAATTGAGCAAAGATTT
TAAGGTATAATTTACGGATTAGGGTAGTCAGCAAACGAAGATATATACATCGAAGAATAT
AGGTCTTTGGCAAACGAATACTCTAATACTCAGGGGAAACTCATCAATCTAAACATGATC
GGACAAGGGGGTTAAAGTCTGGTGGCAGGAACTGTAGCACACTAATTCGATTTGATTTCA
AATGCCTCGACGACTATTTCAGCTTGCAGTTCTATTAATAGTTTGACTGGCTTGCAATAA
AATCCCATGGTTATAAATCAGCAACATTACCTTTTAATGCAACAATAATAATAACATTAA
TAACTAGCTAAACAACAGATTGACGAAGATTACAGTCATTTCTATAGAGGTAATTTGCCA
ACAGCTCACGCCGCTCATTTGGAACTTATGCAATAAAAATAGGCAGCTGCCCCTTCTTTC
TTCAGTCAAGGTGGACTCTATAACGGAGCTCCTCCTTTCGTCCCAACAATTCACTAATAA
TAACAGTAATAAATAAATAGCTCTGTGGGGAATGGAAATGGGATGTAGTTCTATGAAAGA
TTTGGGTCTCCCCCAGCCACTGGAATATCGCCTCTCATGATGTAAACACCTTTACTATAT
TTCCAACCAACAGGAATAAATAGTGCTAAGGGCAGCTACTGA


>Contig22198.0.g120(protein)
MASSSAQVKLNNTQQQPSHQLAFQPVFSQSDPTFAAFQVPSIPYDSMRLQDEHIKDVWID
NLFTELDNIARLIQTYNYVAMDTEYPGTVYLPSEVNNEFEYQMVKVNVDNLKLIQVGITL
SDANGAVPIGVCSWQFNLHYDISQELYAKESMDLLKRSGFDFDKHKSKGIPHEKFAEYLI
TSGLFLNPEVHWITFHGGVDFGYMLKVVLNTEIPNDEANFFEMMNIYFCNFYDIKEIKRD
IDYLTGGLSKIAKELDIERIGTMHQAGSDSLVTCKVFFKLKELFKKWWPNEDSPSIEQRF
QGIIYGLGQSANEDIYIEEYRSLANEYSNTQGKLINLNMIGQGGQSLVAGTVAHQFDLIS
NASTTISACSSINSLTGLQQNPMVINQQHYLLMQQQQQHQQLAKQQIDEDYSHFYRGNLP
TAHAAHLELMQQKQAAAPSFFSQGGLYNGAPPFVPTIHQQQQQQINSSVGNGNGMQFYER
FGSPPATGISPLMMQTPLLYFQPTGINSAKGSY