Identifiers and Description

Gene Model Identifier

Contig13838.0.g20

Standard Name

CNOT7a

Aliases

Contig13838_0_g20

Description

CAF1 family ribonuclease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004553105.0007856079333316e-54CAF1 family ribonuclease conta
ining protein
SGDYNR052C6.002397656030775e-43POP2 SGDID:S000005335, Chr XIV
from 720647-719346, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13838.0.g20(coding)
ATGGCTTAGCCTTTCTTTTAGAATCCATTTTTGAATTTACAAAACTATGGATAGCAGTAT
TTCGCAAGCTTACAGCAGCAGAACCCACAAACTCAATAGGTAATGGGTGGAGTAGGAGTA
GGGGCTGGGATGATGGCATCTCACCAGCAGCAAGTAGTGATAAACCAACAAACTCATCCA
AACATTCAAAATTAATAACAACAGCAGAGCAGTCTCTAGAATCATCATCCACATTCCATT
TCAGAACGAGTTAGACAAATGAGTGAAGTGACATCAATGAATAATGCAGTAGGTGGAATA
AATAACTAAAATGTGCAGGTGAACAACATGACCCTAATGAGAGGTAGAGTAGAAAGCAAT
CAATAATAGGACATGAACCACTTGTTCATGATGAACGCCCAACAAGTCAATTTGACAACC
ACAACCAGCGCAAGTGGAGTTTCAACAACAACTAATTTAGCTTCTATGAATGCGAGGGAC
TTCACAAGTTCAATACCCCCTCATCAGTAATCCATGACACCTCAACCTTCCATTTCTTAG
TAGCTATAGAATCTCTAATCATCAACTAACAACAATAATCTCCTTGGTCAATCTCCTTAA
TCACTTCCATTGTTCAGAGAGAAATCAAGTGAGACTTCAAACATAAAAAATGTGTGGGTA
GAAAATTTTGAAACAGAGCTTCCTATAATAAGTGAACTACTTGATAAATTTCCCTATGTT
GCTATGGACACAGAGTTTCCAGGTGTTGTCATTGACGAGATATCAGAAAACTATAGAAAC
TCAGATCAAAGAGAATACTTGAAGATAAAGTCAAATGTAGATTTATTGAAAATCATTCAG
ATTGGTATTACACTCTCAGATGAAAACGGAAACTTGCCTGAGCCAATATCAACCTGGCAA
TTTAACTTCAATTTTGATATTGACACTGAGAACAAGTCAAGCACTTCAATCAATCTTTTG
TAAAACAGTGGAATAGATTTCCAACAATTGAAGAGACACGGTATCCATCCCTTGTATTTT
GCCGAAAAAGTTACTCAATCTGGACTTATTCTGAATGACAGAATACACTGGATTTGCTTT
CATGGTTGCTATGATTTTGCATATTTGTTGAAAATTATGATGAATGAACTCCTTCCAAAG
TCAAAGGAGAATTTTTACTAGCTGCTAAAGATATTCTTCCCAAACATCTACGATATTAAA
ACCTTCCAACACGAGTTCTACGATTTGATAGAAAGCGGAGGTTTGAACAGAATAGCTGAT
TAACTTGGCATTCAACGTATCGGCATTACTCACTAGGCTGGGTCTGATAGTTTGGTCACA
TCCCAAGTTTTCTTTAAGCTAAAGTAGAGCAATCCATCATTATTCCCTTAGATCTAAACA
GACTACAATTAAGAAGTTTATGGCTTTAGCAATGATCAGGCTTACCCATCTGTGAATAGA
GCACCTGCTACAATCCATCACATAGATCCCTTAGCTTCTAACAATTATGAAGACGGCGAC
AATACTCCTCATGAACTCTTTTACAATTTTGTGCCAAACGGAGACTATGACGGTGGCTTC
TTCTACAATGGTTTGAATACAGCAAGTTCAAATAACCTCGACTTAAATGTCTTCCAGCCA
ACAAGAAGTGGCGCTACAGGCTCTTAAAGCTTTTAACAACAGCAATTCAATCAGCAACAT
TAATTTCTCGATGGTAAGAAATCAAGCAAGGCAAAAGATAACAACATGTTTTTAGATGGA
AACACTGCTAACTTTGGAGGAGCCAAAACATTAGGAGGAATGTCAAGCAATCATTTGTTG
TAAAGTACCACTCCACCTCCCATGATTATTGATAATCAATTTATGATGAGAAATTTAACT
CCAAGCTAAAGTCATGGCATATCATCTGTTGGCATGGGCAATACTGGCTTAGATTTGCTT
AATCATCAATTCTCATAGCATCATCATCCAAACCATTAATCATCCTGGAACTACTACAAC
GGCAGCAACAACGGACACTAAGGAAGCTTTTAAAACAGCAACGGAGGCTTTTATCAATGA


>Contig13838.0.g20(protein)
MAQPFFQNPFLNLQNYGQQYFASLQQQNPQTQQVMGGVGVGAGMMASHQQQVVINQQTHP
NIQNQQQQQSSLQNHHPHSISERVRQMSEVTSMNNAVGGINNQNVQVNNMTLMRGRVESN
QQQDMNHLFMMNAQQVNLTTTTSASGVSTTTNLASMNARDFTSSIPPHQQSMTPQPSISQ
QLQNLQSSTNNNNLLGQSPQSLPLFREKSSETSNIKNVWVENFETELPIISELLDKFPYV
AMDTEFPGVVIDEISENYRNSDQREYLKIKSNVDLLKIIQIGITLSDENGNLPEPISTWQ
FNFNFDIDTENKSSTSINLLQNSGIDFQQLKRHGIHPLYFAEKVTQSGLILNDRIHWICF
HGCYDFAYLLKIMMNELLPKSKENFYQLLKIFFPNIYDIKTFQHEFYDLIESGGLNRIAD
QLGIQRIGITHQAGSDSLVTSQVFFKLKQSNPSLFPQIQTDYNQEVYGFSNDQAYPSVNR
APATIHHIDPLASNNYEDGDNTPHELFYNFVPNGDYDGGFFYNGLNTASSNNLDLNVFQP
TRSGATGSQSFQQQQFNQQHQFLDGKKSSKAKDNNMFLDGNTANFGGAKTLGGMSSNHLL
QSTTPPPMIIDNQFMMRNLTPSQSHGISSVGMGNTGLDLLNHQFSQHHHPNHQSSWNYYN
GSNNGHQGSFQNSNGGFYQ