Identifiers and Description

Gene Model Identifier

Contig21935.0.g15

Standard Name

CNOT6b

Aliases

Contig21935_0_g15

Description

Endonuclease/Exonuclease/phosphatase family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam03372 ) Endonuclease/Exonuclease/phosphatase family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011264104.9985000769285e-31Endonuclease/Exonuclease/phosp
hatase family p...
SGDYAL021C1.0002869940498747e-21CCR4 SGDID:S000000019, Chr I f
rom 113359-110846, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21935.0.g15(coding)
ATGCTTCGAGGTGTGTAGAATAACAAACTGTACATGAAAGTGCTCTCTTACAATATTCTC
GCTGACTGCTACTCGCATTATTTTATGTTCAAGTATGTGGATCACGCCTATTTAAAGTTT
GGTTTCCGATCGTATCGCATATTAGAGGAAATTAAGAGCTCAGATTCTGATATAATTTGC
TTGTAAGAAGTAGATCACATAAAAGATTTTTACAAGCCAAGGTTAGAATAACTAGGGTAC
GATCTCCAATTCACGCTTAGAAGAGAAAAAGATGCAGTTATGGTTGGATATAAGCGGGAT
TAGTTTGTTTTGATAAAAAGTGAACCTGTGGACTATAATGACGTCGCAGAGCTATTTGAT
GATAAAAGCTTGAAGCTACACAACAAAGCTATTATATGCCTCTTACAACATAAAGAATCA
CTTAAATACTTCATTGTGATAAGTTCTCATCTCTATTGGGGTTAGGATTTCGTCCGCAGT
GCCCAAATTTTGTACCTAATAAAAAGACTATCGTCTTTCATCGAAAATGAAGTTGAGAAA
TTAATGTCTAAGGGAAGCCAAATATCTGTGATTGCATGCGGTGACTTTAACTCTGGAATT
AATAAACCTGCTATTAAGATGATGTATGGAGATTAAACTATAATTAACTAAGAGATGAAG
ACAGATAGTGTTACAAAAGAAGACTCGACACTTCTACCAAAAGATAGCAGTTTAGTTTAA
GACTTAAAACTATCGCCGAAAGAATGGGAACTCTATAAGAAAATTCTAGTCGAATACAAA
AAAGAAGCAGAACATCTAAATCGAGTGAAGTTCCTAAGTGCTTATCAAAATTACTTTGAG
CATGAACATAGCTAGTAGTGTAAAATCTAAAACTTGACTAAAGTTGAAAATAATCAAGAG
ACTTAATAGGAGGGACCAGTTTAAGAAAGTTAATTGACTCAAGACTATAATTGCCGAGTT
AAGGGGCATCCACTTCACACAAACTTTACTTCCAAGTATTAAGACCATTTTGACTATATT
TTCCACACTAATGACATGAGCGTTGAAAGTCTCCTTGAAGTTCCAACACTTGATGTCTTA
ACCAAAGAAACTGCTCTACCCAATAAAATGTTCCCTAGTGACCATCTCAGAATGGAAGCA
ATTCTTAGTATGAAGTTATGA


>Contig21935.0.g15(protein)
MLRGVQNNKLYMKVLSYNILADCYSHYFMFKYVDHAYLKFGFRSYRILEEIKSSDSDIIC
LQEVDHIKDFYKPRLEQLGYDLQFTLRREKDAVMVGYKRDQFVLIKSEPVDYNDVAELFD
DKSLKLHNKAIICLLQHKESLKYFIVISSHLYWGQDFVRSAQILYLIKRLSSFIENEVEK
LMSKGSQISVIACGDFNSGINKPAIKMMYGDQTIINQEMKTDSVTKEDSTLLPKDSSLVQ
DLKLSPKEWELYKKILVEYKKEAEHLNRVKFLSAYQNYFEHEHSQQCKIQNLTKVENNQE
TQQEGPVQESQLTQDYNCRVKGHPLHTNFTSKYQDHFDYIFHTNDMSVESLLEVPTLDVL
TKETALPNKMFPSDHLRMEAILSMKL