Identifiers and Description

Gene Model Identifier

Contig969.1.g36

Standard Name

CNOT6a

Aliases

Contig969_1_g36

Description

Endonuclease/Exonuclease/phosphatase family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam03372 ) Endonuclease/Exonuclease/phosphatase family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005642908.002082816694397e-20Endonuclease/Exonuclease/phosp
hatase family p...
SGDYAL021C0.0000000000019997478866288316CCR4 SGDID:S000000019, Chr I f
rom 113359-110846, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig969.1.g36(coding)
ATGAACTAAGAGTTCAAGCAGCACTAGCACATTGAAGAGGAAGAAATCAAGTAATCTTCT
CAAGTTTAGCCTCAACAAAATCATAATAATTTCTAACAACCAAACCAGACATACCCATAA
TATAGCAATAGTGGTTTAGATTAGTAAAATTAAGGCAATTTGTCAGGGAGAAATACATCA
GGGCATAGAAGAGTAGTTGATGCTAATAATTAGCAAGAGCAATAAAATTTAGCATTAGAT
GGTGCAAATGGATAGTAAATGAATAATAGTCACTAGCATGATAATTAGCATTAAAGGTAT
CAAGGTCATTAAAACCAACATCAGAGAGGAAGAGGAGGTGACCACCACTATAAACAAGAG
TACAGACCTAAATATAACCAATACAACAACAATAATTACTAGTAAGACGGGAATACCAAC
TAATATAGAGGTGGAAGGGGAAGAGGTGATCACCATAATCAACATCATAATTAAACAAAC
TTTTAAAACTAACAAAATCCCAGAAATCATTATCAACACCAACCTCAATATCACAATAAC
AATTAATTCTACCAATAGCAATAACCTGGGTTGGTTTTGACATAAGAATAGCAAAGCATT
GTAGACTAGATAAGCACTGTTGTAAATTAAGTGAATGGCGCTAGCTAGGTTTTCATTTAA
GGTACATAGATCCAGTAATCAGAGAACATCTCACTTAATATAGGTGCTCAGCCTTTTTAA
GCCAAATAGTTTATTCCAGCGGTTAAGAACAAGCAAGACGATGCCATCAGAGGCTTTAAA
AATGATATTGGCAGGTTCTTAAAATATGGCAGAGGCTGGTTCCCAAATAAATTACCACAA
TCTATCTCTAAACTGCTCTAAAAGTAATGCCCAGAAACTGGTGCTCTTAAACTGACGAAA
AATTGCTTAAGAGTTATGTCATATAATGTTCTGGCCACTACTTTGACTGGTCATTTCGAA
TACGGCTGTGACCCTGAATTCATAAAACAAGAAAACAGAGTACCGCTAATAAGAAAAGAG
ATAGCTTTCCTCAACCCAGACATTTTATGTTTACAAGAAACAGAAGACCACACCAGTCTC
CACGACTATTTGATAAACGACTTGAAATACGAAGGTTAATTTTTAAAGAAAGACGATCCT
ACGAAGCACGATGGATGCGCCACATTTTACTCAACTGAAAAGTATATTATGATTCAGAAA
TTTGAAGTTCATATGGGAGCAAATAAATACTCTGAATTGTACTAAAAACCACAGGTTTAG
CTTATTTTAGCTTTGTAACCAGTGGATTTTCCAGATAGGGTGCTATTGATTTCAAATACT
CATCTGTACTTCAACATCAACAGAGGCGATGTGAAAATGGCTTAGCTAAAGATGACGACT
GACACTATATCACAGCTAAGAGATTACTATCAGTAAGTCTTAAAGAAAAAAGTGTAGATT
GTGATGTGTGGCGATTACAATGCAGGTCCGAGGTCAGGCGTATACGATTTCATGAGAAAT
GGGGAGTACGATTGCCTGAAGCTTTCTAGAAATACCATAAGTGGCTAATATCATGGATCT
TTCAACTATAAAGATGGAATTACTTCAAGCACTTTACAAAGAACTTGCTATAACATTGAT
GTAGTTGCAACAATGAATGACTCGAATAGAATAGCTGAGTGGTTCACTGAGATAAATTAC
ACTCAACCCAAGCTTATATTTGACAACGATGGTTAGCCACTTAAATTCATTCTGGAAACT
ATATTGCCATTCGAACAAATCGACATGAAGAGAAAGAGGCCTTAAGCACAGGCTTGCAGA
GAATTACAGGACATGATGGAACAGGAAATTCATTAATTAAAGTAAAAGGGTTTCTCTATG
AAGTAAATATTGCTAGATAAAGACAGAAAGTTCTTCAAGCTTTTAAATAATTGTGGGTCA
TTCAAATCAGCCTATGCTTAAAACTTGCTTAATCACGTTCATTTCTTGAATTAAATCAAA
GATGATACTTTCCCTTTGGAATATCTAGATATCTACTCAAAGAGGCCAGAAGAAAATATC
TTAAGCGAATTAATCATAGAAGGAGGGGGTTCTGGAATAGACCCACTTGGTTTTTACTAG
CCAGATAAGGATGAGGTTTATGGGTGCTATAAATGGTTGAAACCTAATCTAGATTTGAGA
GAGTGGTTGAAAAGAATGTCAATTATGACAAAAGAGCCCTGCTTTACTTCTTATACAAAT
ATTAAACTGCCTGTGGACTACATTTTCTATTAGGGTGAGGGCATGGAAGTTGTAAGAGTG
CTGGACTTGCCATAATTTAGCAAATATCTCAAGGATAATATTAGCTGCTTACCCCATCCA
CTTATGCCAAGTGATCATTTCTCATTAGTTGCAGATTTTCTAATTTAATGA


>Contig969.1.g36(protein)
MNQEFKQHQHIEEEEIKQSSQVQPQQNHNNFQQPNQTYPQYSNSGLDQQNQGNLSGRNTS
GHRRVVDANNQQEQQNLALDGANGQQMNNSHQHDNQHQRYQGHQNQHQRGRGGDHHYKQE
YRPKYNQYNNNNYQQDGNTNQYRGGRGRGDHHNQHHNQTNFQNQQNPRNHYQHQPQYHNN
NQFYQQQQPGLVLTQEQQSIVDQISTVVNQVNGASQVFIQGTQIQQSENISLNIGAQPFQ
AKQFIPAVKNKQDDAIRGFKNDIGRFLKYGRGWFPNKLPQSISKLLQKQCPETGALKLTK
NCLRVMSYNVLATTLTGHFEYGCDPEFIKQENRVPLIRKEIAFLNPDILCLQETEDHTSL
HDYLINDLKYEGQFLKKDDPTKHDGCATFYSTEKYIMIQKFEVHMGANKYSELYQKPQVQ
LILALQPVDFPDRVLLISNTHLYFNINRGDVKMAQLKMTTDTISQLRDYYQQVLKKKVQI
VMCGDYNAGPRSGVYDFMRNGEYDCLKLSRNTISGQYHGSFNYKDGITSSTLQRTCYNID
VVATMNDSNRIAEWFTEINYTQPKLIFDNDGQPLKFILETILPFEQIDMKRKRPQAQACR
ELQDMMEQEIHQLKQKGFSMKQILLDKDRKFFKLLNNCGSFKSAYAQNLLNHVHFLNQIK
DDTFPLEYLDIYSKRPEENILSELIIEGGGSGIDPLGFYQPDKDEVYGCYKWLKPNLDLR
EWLKRMSIMTKEPCFTSYTNIKLPVDYIFYQGEGMEVVRVLDLPQFSKYLKDNISCLPHP
LMPSDHFSLVADFLIQ