Identifiers and Description

Gene Model Identifier

Contig19.1.g91

Standard Name

CNOT4b

Aliases

Contig19_1_g91

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004448309.99723014177113e-33hypothetical protein
SGDYER068W1.9991095569230066e-20MOT2 SGDID:S000000870, Chr V f
rom 293050-294813, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19.1.g91(coding)
ATGAGCTATTCCCGGACTCCTATTTCCAAAAGAAATTTCAATAAATAATCATATCAAAGT
TAAAATAACGTGGGTGGGGCGTACAGCGGTGGATACATGTCTGCTGCTAGAGCCAAGCGC
GAGCCATACTGCCACTACTGCAAGCAAGATCTCTGTGATGAGGAACTTGATTTTTATCCA
TGTCCCTGTCGATACTCTATATGCTACGAGTGCTACCAAGCCAGTATGGAATCAAAGGAG
AGAAGATGCCCATTTTGCTAAAAATTTTACGAGGGGCATCACCATTATTAGTATCAGTAA
TAGTAATAATACAAGTAGTAGATGTAGCAGTAGTATTATCAATAGCATCATTAAAATTAC
AACTCTGCTTCATAGTCGAAAAATGAATACTATAAAAAACCAAATCAAGCCATTAGTGTC
AGATAAGTCAAGAATATCTCATCTACTTAAGAGACTTATTCCTCCTCAAACATGAGCTCC
AATAGTAATAAGTATGGTAGTCAGAACAACGCTAGTCACCAACTATAACATCAAAATTAG
ACTTAACTTAACCCCAATAAACTTCAATACAAACAATAAGCTTAGCTATAAGCCAAGAAA
ACCAACTCAGACAAGAACATTACTCCTTAAGCCGAACTTTAACTGTCTAAAAATCCCACA
TAAGATACTTAGTCAACCACATCATCCTAGCAACCTACTTGTCATTAAAATAAACTCAGC
TAGATTAGAATCTTATAAAAGCATATTCTCTATGCAATAGGCCTATCTCCCTCAATAGCA
AAGGAAGATATATTGAGGAGATATGACTTCTTTGGATAATATGGAAGAATAATGAGCATT
CTAATTAACAAAGAAAAGGCTTACCAAACCGAGAATCAGTTACTATGCTATTCAGCTTTT
ATCACTTACTCTCAACCTCAAGAAGCATCGATTGGAATATTGGCTGTAGATTAATATCAA
TATGATGGGAGAATGATTAGAGCTTCCTATGGCAGAACTAAATACTGCAAATTCTTTCTT
AAAGACACTCAATGCTTAAATAAAGATTGCCCCTACTAACATATGATGTGTGATTAGAGT
GAAATTTTGACGCAGGATGACATGCAAAAAAGTTAAATATTCCAGTAATATTAAGCTTTA
GCCTTTCAATTATCACAAGTTTGCATGCTAAATGAAGATCAATTTAAGTCCTGCATGAAA
ACATACAGAGAAACATGCTTAGGCATTGTAAATTAGAATTTTGAAACTGTTATGCCAACA
CCAGAATCTATATATGAGAAGAAAGCACTGTTCAAGCAGTATGAGCAATATAAAAAGCAA
AACTAAAATTTGATCAAACACATGACTCTATAAGCTTCATCCAATGCTTAATCCTAATCT
CAAAAGAAAGACAAGCCTTTAAAATCTCAAGTTTATCAAATTAAACCTGCATAATCACGT
AATCATGGTTTGCTCTCAACTCAATCGTAATGTTTCTAAGTAAAGAATAAGACTCATGCT
TAGCTTAATACACCTTAGCACTAACAAATTTCTATTGCATAAAGTTTAGAATAATATAAC
TTGGCAGATACATAGAGTGATAATATAAGTTTGAGTAATCAAGAATTGAAAAAGCAAAAG
AGAAACAACTCAACAGATGAACTAAGAAATAAAATACAGCAAGATAGTAAATTTGAATCT
ATAAAGACATTTGAGCAATAGATATCTGAGAGCTTGAGAAAATTAATCGATACACAAGAT
GTTCAGGATAAATCTTCTTAAGAAACTGATAGCAAAAACAGCTAAAGAAAGAGTAGGTAC
CAAAATTCAAGTTAAGATGGTAAGGATGGGATTGAAAGAGCCCCAATAAGAGACATTAAG
CTATCTAGAAGATCAAGTGTTGGATAAGGTTATCAAAAGAAAGGCTCAATGAAATCTCTG
ATTGTTGAAAGCCTGAAGTTTCTAATTGACGACACTGATGTTGTCCCTAACAAAAGAGAA
CCACTTATAATTAAGAAGGAAACTAATCCTCCCAGTGAGATGTTCAATGTTGCAACACCA
GCCTAGTCACATCTAGGCGGCTATAATGAAGATGAATATCTCTGGAACAGCACACTTTTT
TCATAACATGACTTAAGTCATTAGAAAAACATGACACCTCTTGATGATAAAAGCTGTTAT
TCTCATTAGGGTTTCAATAATACTTACATGAACAGTACTGGCAAAAATATAAATGGGTCA
TCTGTATTCAATCAGTCTTACTTCAATTAACATTAACAGTAATAAAGAGTCTAGCCTTTT
AATGATAGCAATTTTTGGAACAGATCATAAAATGGAAATAACAATTACTTTGGTAGTCAA
GGGCCAAATAATCAAAACTTGATGCAAACGTAAAGCACTTACTATCAAGTAGGAAGGAAG
ACAACTCTAGCAAATGATCAGATTTCATCCAATAACATTGGCACAGACAACAAAAGCGCT
TTGTAATTGACAAGATCACCAAGCTAGCCAAATTATGAAAAATTGTAGCTTGGGTAAATG
GCAACGAGAAATGGCTTGAATACACCATATCACCCGTCTCAAATGAGTTTAATGTATAAC
TCCTAGACACACTCTCAATTTTAAGATCTGTATAATCAATAAAGAAAATCTTAGCAAAAC
ACTACTCCATTTAGTGTGACTGATCAAAACAGCAATAAGCATTCCTACAAATTGAATCAA
TAAAATCTAGACCTCCTGGATAAATATTATAACGACACTAGTACATATAGAGATTTGTAC
CATGCTAAGATTTTTACACAAGATGGTACAGCTTCTTAAAACAACATCATATCTTCTCAA
TCTCTATTTTGCTATAACAGCCAACTTGAAGATGAACGAGGCGTTGAAATTACTGACTTT
AATAAAAGATTTAGCAAACTGTCAGAAAGAGGGTTGATACCAAGAACCCCTGTGAAAGAG
AGCGGCTGCTTTTTTAGACTAACCGATGATGAATTTTTCTAAGATGATAGTCAGTATGAT
TAAATCACTAAAAATAGTGAGCCCAAGAACTACTACAAAGAATTCTTAAGCATAAAAGAG
AGTAGTATCTTTAGTGGTAACCTATTCACAAAAAGAAGAAATTCCTTAGAGTAAGATCGA
GATAAACTTCAACCTCAATCCCTTCAATTCAACAATACTCTCTCAGGATTGATAGGAGAC
CACCAGACAGATAACGGTCTAGGAAATGGAAGAAGTAGCAACCTCACAAATGGACTGAAT
AATACAGGAGTCATAGCTGCCATTTCGAATAATTTGATTGCTCAGGGAGGTACTCTGACT
GTAAGTCATTCAGCGTCTAAAAACAGTAAATCTCGATCTAAAAATAGAAAAGCGACTGCC
ATGACAGCCAGAAACTATTGA


>Contig19.1.g91(protein)
MSYSRTPISKRNFNKQSYQSQNNVGGAYSGGYMSAARAKREPYCHYCKQDLCDEELDFYP
CPCRYSICYECYQASMESKERRCPFCQKFYEGHHHYQYQQQQQYKQQMQQQYYQQHHQNY
NSASQSKNEYYKKPNQAISVRQVKNISSTQETYSSSNMSSNSNKYGSQNNASHQLQHQNQ
TQLNPNKLQYKQQAQLQAKKTNSDKNITPQAELQLSKNPTQDTQSTTSSQQPTCHQNKLS
QIRILQKHILYAIGLSPSIAKEDILRRYDFFGQYGRIMSILINKEKAYQTENQLLCYSAF
ITYSQPQEASIGILAVDQYQYDGRMIRASYGRTKYCKFFLKDTQCLNKDCPYQHMMCDQS
EILTQDDMQKSQIFQQYQALAFQLSQVCMLNEDQFKSCMKTYRETCLGIVNQNFETVMPT
PESIYEKKALFKQYEQYKKQNQNLIKHMTLQASSNAQSQSQKKDKPLKSQVYQIKPAQSR
NHGLLSTQSQCFQVKNKTHAQLNTPQHQQISIAQSLEQYNLADTQSDNISLSNQELKKQK
RNNSTDELRNKIQQDSKFESIKTFEQQISESLRKLIDTQDVQDKSSQETDSKNSQRKSRY
QNSSQDGKDGIERAPIRDIKLSRRSSVGQGYQKKGSMKSLIVESLKFLIDDTDVVPNKRE
PLIIKKETNPPSEMFNVATPAQSHLGGYNEDEYLWNSTLFSQHDLSHQKNMTPLDDKSCY
SHQGFNNTYMNSTGKNINGSSVFNQSYFNQHQQQQRVQPFNDSNFWNRSQNGNNNYFGSQ
GPNNQNLMQTQSTYYQVGRKTTLANDQISSNNIGTDNKSALQLTRSPSQPNYEKLQLGQM
ATRNGLNTPYHPSQMSLMYNSQTHSQFQDLYNQQRKSQQNTTPFSVTDQNSNKHSYKLNQ
QNLDLLDKYYNDTSTYRDLYHAKIFTQDGTASQNNIISSQSLFCYNSQLEDERGVEITDF
NKRFSKLSERGLIPRTPVKESGCFFRLTDDEFFQDDSQYDQITKNSEPKNYYKEFLSIKE
SSIFSGNLFTKRRNSLEQDRDKLQPQSLQFNNTLSGLIGDHQTDNGLGNGRSSNLTNGLN
NTGVIAAISNNLIAQGGTLTVSHSASKNSKSRSKNRKATAMTARNY