Identifiers and Description

Gene Model Identifier

Contig22254.0.g55

Standard Name

CNOT4a

Aliases

Contig22254_0_g55

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13932 ) GidA associated domain 3

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004448306.00092892288903e-46hypothetical protein
SGDYER068W2.000130478826482e-26MOT2 SGDID:S000000870, Chr V f
rom 293050-294813, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22254.0.g55(coding)
ATGGAGAAAAATGAATATGATCAAGCTTATCACAATGGGCAAATGAGTTAGAGCGATAAG
AAGAAAGATCCAAATAATCTCATAGGGTAATACCAAAAGTTATCTTGTGTATACTGTTCA
TCAAGGCATTCCATCTCCGACATAAGCTGCGTGAAAAATTTAAAGAGCTTTGGGTTTATT
CCTCCGAAAGGCACAAATAAAATACTAATAAGTACACTGTCGAAAGAGAAAATAAAAAAG
TTGGAGAATTTGAGAGTTATTCAGAAAACGCTAGTTTATGTAATTGGAATCGCACCCGAA
ATTGCACAAGAAGAGATACTCAAATCACCTGAGTATTTTGGACAGTATGGAGATTTGACG
AAGGTTGTTGTAAATACTAACAATGTGTATAATGCAACCAGGGGAGGTCCTTCTTATTCC
GCATATTTGACATTTTCGCATCCTCGTGAAAGTGCTATAGCCATTTTGTCAGTGGACCAG
CACCAAGTGCACGAAAGAGTGCTGCGCGCATCATTTGGCACATCTAAATTCTGTCAGTTT
TTTATGAACGGCCAGAAATGCACAAATAAAGATTGTTTATACTTGCATGAAATAAAATGC
GATTTAGAGGCTTATACTAAAGAGGACATGCAAAATAATAAATTTATATTCTAAGAGCAG
CAGAAAATTGCTATTAAATTGTCTAGAGCACTGGAGTTTAGCCTTGAGGAATTCAGAGAT
TACAACAGAGCAAATAATAAAAATCTGCCTCCAGAAAATGTAAAGTTTGAGCCTAAAATT
CCCTCACCTGATACCATTTATTATAAAGACTTCCACTTCCTAGATGAACCGCTAATCAAC
AGGAAGCACTTCCCAAGCAACTTAAACAAACCTCAAGCAGACTAGTAAAACGACTAGACT
TCACAATAAAATCAATCCTCAGCAGACAGCTAAAACGAGAACAAAGCAAGTTCAAATGGT
TCTTAGAGTGGACATCAGCAGTCGCAATCAGTAGACCAAAATAAAAACGCATCATCCACC
TCATTAAATAACATAGCAGTGGGTAGTGGTGGACACTTGAAAGAGAATGGAGTGATATCA
GGAGGCAGTGGAAGTAATTAGAACTAGGCTCATTCGCAATCTGTACCAGCTTCAACTTCT
TCAAACAATTTCCCCTCTAGCAGCAACTTGAAAGAGTAGAAGGAGCAGCAGAATTAGAAG
GATGAAATCTCTCCCATAGCAATGACTCTGAGTAACCAGAAGGACTTGAATAATTAAAAT
GATAGAAATCAATCAAAGAACAGAATATAAGTAGCAGCAAATAATTAAAGTAAATCAAGC
AGTAGTAATTTAATTGCTAATAATATTAATAATACTAGTGAAAATAATAACACAAATAAT
CATGAAAAAAGTAAAAAAGAAACGATTACAGCTAAAAGCAGCTCATTAGGTCTTAAAAAC
TAGACTTTAAACACCCCTATCTAAGACGACTAAAATCAATCGAATGCAAATGATAGGGAG
GAAAAGAAGGAGTCCAACAATCAATATTCTGATGATGATTCTTTTATCAGATAGCAGGAA
CTATTTGTGGATGAAATCCTAGAAGGGAAACAATCAACTCCTTCTTCCAAAACAGCATAG
AATCATAACTCATCAAAGAAAATGGCAGGCATTAAGTCACTCACACTTGAGAATTAGACA
GATTCAAATAGCAAGCAAGTAAAAATAGAAACTCCTAAGGATTCTACGAATGCGTTGACT
AGTTCCCGTAAAATCTTTGACCTTTCTGCTCAGAATCTCAAGAGCAAAGAAATTTTAGAA
TCAGTTTAACATGATGGAGCACCCACTTTGAATAAGCAAAGCAGCTACCAAGGTGGACTG
ATTAGCTCACTCGATTAATTAGTTCTGGCTTAAGTGAATAACAGAAAGAGTGAAGTTTCA
ACTATTAGCAAAACCCCACCGCACAACGATGACTAGCTAATGTTGCAGATCTCACAACTT
CTCTCTCCAATGCTTTTCTCAAAGAAATAACAAAGCAGGTTTCAATTTGCGCATAGTGTA
GACCCTATTAAAACCACTGATGACTGGGATGAAATCGAGGTACCTGCTAAAATTTAAGAT
CTAATAGAGAGAAACATTCGCACACTAAGCAATAGTTTGAGCAATAAAGGACATCAGGAT
GTTTATCAAGAAGTAGCTTTAGGCATAAAAGATTTGAGAGAGAAATGGCTAACTAGACAA
GAGAAACTACTAGAAGTCAATCCTAATACATAAAATGGAGGACTTTTAGATCATTAGCTG
AGAAACAGAAAGAACGACGGAGATGACTAGTCATCACTGGAGGATAATCGCATGCTCAAA
TTCAAGTAGAAGAAGGAAACACAGATTGATGCGAATGGCAAACCTGTTTATAATCTTACT
GAGCACTCTCAAAACATCAGAGTTAAAATCAATAGATAAAATAGCAAAGATAATCTAACC
AGTGAAAATGACAAATTAGAGAAAACCCAAGCACAAAATTAATAGCACACTCATTAAGAT
CAAAATACTCACAATCAATAAATAGAGAACAGCAGCAGCAGTGCAACTTTTGAAGACGGA
AAATCTTCTTCAAGAGCTTCCTCTCTAAATTACCAGAAAACTTCAAATCAAAATAACTAT
GGAAATAGCAGTGGGTACTAATATAACAATTACAATAGTAAACAGCAGCAATAAATTAAG
AGACGCAGAAAAGAAGAGAAGAGATCAGACATACACAACAGCAATGCTTTTACATACAAC
AAAATCAGAAAAGTCAATGAATGA


>Contig22254.0.g55(protein)
MEKNEYDQAYHNGQMSQSDKKKDPNNLIGQYQKLSCVYCSSRHSISDISCVKNLKSFGFI
PPKGTNKILISTLSKEKIKKLENLRVIQKTLVYVIGIAPEIAQEEILKSPEYFGQYGDLT
KVVVNTNNVYNATRGGPSYSAYLTFSHPRESAIAILSVDQHQVHERVLRASFGTSKFCQF
FMNGQKCTNKDCLYLHEIKCDLEAYTKEDMQNNKFIFQEQQKIAIKLSRALEFSLEEFRD
YNRANNKNLPPENVKFEPKIPSPDTIYYKDFHFLDEPLINRKHFPSNLNKPQADQQNDQT
SQQNQSSADSQNENKASSNGSQSGHQQSQSVDQNKNASSTSLNNIAVGSGGHLKENGVIS
GGSGSNQNQAHSQSVPASTSSNNFPSSSNLKEQKEQQNQKDEISPIAMTLSNQKDLNNQN
DRNQSKNRIQVAANNQSKSSSSNLIANNINNTSENNNTNNHEKSKKETITAKSSSLGLKN
QTLNTPIQDDQNQSNANDREEKKESNNQYSDDDSFIRQQELFVDEILEGKQSTPSSKTAQ
NHNSSKKMAGIKSLTLENQTDSNSKQVKIETPKDSTNALTSSRKIFDLSAQNLKSKEILE
SVQHDGAPTLNKQSSYQGGLISSLDQLVLAQVNNRKSEVSTISKTPPHNDDQLMLQISQL
LSPMLFSKKQQSRFQFAHSVDPIKTTDDWDEIEVPAKIQDLIERNIRTLSNSLSNKGHQD
VYQEVALGIKDLREKWLTRQEKLLEVNPNTQNGGLLDHQLRNRKNDGDDQSSLEDNRMLK
FKQKKETQIDANGKPVYNLTEHSQNIRVKINRQNSKDNLTSENDKLEKTQAQNQQHTHQD
QNTHNQQIENSSSSATFEDGKSSSRASSLNYQKTSNQNNYGNSSGYQYNNYNSKQQQQIK
RRRKEEKRSDIHNSNAFTYNKIRKVNE