Identifiers and Description

Gene Model Identifier

Contig21723.0.g24

Standard Name

CNOT3

Aliases

Contig21723_0_g24

Description

NOT2 / NOT3 / NOT5 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( pfam04153 ) NOT2 / NOT3 / NOT5 family
  • ( pfam04065 ) Not1 N-terminal domain, CCR4-Not complex component

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001610702.9990241513684e-21NOT2 / NOT3 / NOT5 family prot
ein
SGDYPR072W0.00000000000001000191320216021NOT5 SGDID:S000006276, Chr XVI
from 690107-691789, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21723.0.g24(coding)
ATGGCGAAGAATTAGCGAAAGCTATAGTCAGAATTAGAAAAAAATTTGAAAGCCATAGAT
GAGGGAATTTTATAGCTGGAAACACTGGAACAAAAGCTTAATAATGCGCCAGCTATGAGT
ACTAAGGAGAAATATGAGATTGAAATGAAAAAGGAAATTAAGAAGCTATAGAGAGTTAGA
GATTACTTCCGTGCTCAGATCAATAACAGTGAAATCAAGGATAAATCTAAACTGTAAGAC
GCCCGTAGGCGTGTTGAAATTGAGATGGAGAGATTCAGAGCCCACGAAAAAGAGTTCAAA
AAGAAGCAGTTCTCGAAGAAAGCTCTGCAAGCTATGAACAAAGATCGCAATAGAGATGGG
AGCGGCAGTGATGACGGGAGTGACTACGGAAGCAACGACTGCAGCGATTATGACGATGAT
AACTCAGAGATAGACTACGGTGATGGAGACTCAGATAGCCAAAACGATGAGGATGGAAAT
TAAAGTGAGGAAATTAGTGAGGAGATGCTAAATCAGCTGAAACTCAAGGACAGGGAGTTC
TTCGTAGAGGTTCTAGACTTCTTTAAGCAGCAAGCATCAAAGTAGGAAGCAGAACTCGAA
GTACTCAGGAATAAAAAAGTCAAAGGTCCCCCTAAAAAATAGAAGGAAAAATAAGTTGCC
CTGAGTAGCAAAGTAGCTCAAGTCAAAAAGATGAGAGATAGGACAGAAGAAATCGTCAAT
AATCTTGAGCATATCGATCTATAGCAAGTTAAGAATCTGAAAAGTTTGCTGGCATAGTTC
ATGTTAATCCCAGAAAGTGAAGAGGCTTCTTGCAACAGTGTTAAAACTTAACAGATTGAA
CTTGAAATGGCTAGATTAATGGAAATAGCTGAGGGAAGCAAAAAGATTCAATAAAGCAAC
CTACAGATGCAACGTGATCAGCTTAAAGCTCAAGAAATCAGATCGAAAGTGGATTTAGAT
CGTCATAAGGATGTAATTAAGGACTACTGCAGAGTGGAGTAAACTCAAGTTGGAAACATC
TTGGATGCCTAGGATTATCTTGGTAATTGGCATCTCGCCATTGTGATTAAAGAAAAGAAT
GCGAGAGAAAGAGACATTCATTTCTTGCCATACAACAACCACAAGAGAGATGAGACATTT
ACAGATGAAGATTCTAATAAAATAGCACCAGCTTTCACAAATACTGAAATCCCAGGAGAA
CCAGATAAATCATTTACTACCTTGAGGGAATATTTAGGACAGCTATAGAAGAAGCTTGCT
CAACAACCCCCAACATAGAATGTGGCTTTAGAGGAAAAGAAAGTTAGTTAAACTGCGCCA
TCTTAATAGCAATAAACAGCAAAACCTGTAGCATAATAATAGCCAGTTCAAAAGACCTAG
TAACCTTTAGCATAGCAGAATAAAAAAGGCGAAAAAGTATTAAAATAGAAAGTGTCATCA
GAGGAAGAAGAGAAGATCAGCCCTTCAAATCAAGTGTAGTAAACTGCTGCACCAATCTTA
TTTGGAGGTAATATGTTTGCAGGCCCTGATCCATTCAGCTAATTAATGAAACAGAATTAA
CTATAGCAACAAATATTAGGCATAAACCAATCACCATCACTGCCTGTAGAGACTATAGAT
ACTTCTCTGAGTAATATTGCATCAAACATTTTGAGCACATAGCAAGTACCAGTTTAGCAG
TCAACAAGTTCAACTAATGTAAACAGCTAATTTATGGATAAGACCCAACAAGTACTGGAA
CTATTAGAAGCCTCTTATAGAAACATACCACAACCTTAAGATTAAGAAGTTAAAGAAGCA
AAACATCCAGTTCCACTTAAAGAGGATAACATGTTCCCAACAGTCCCTATGTTCAACAGG
AGAGAGAACTTCTCACGATTTGACTTAGACACTCTTTTCTTTGCATTTTACTATCAATAA
GGTACCTACCAGCAATATCTGGCAGCTATAGAACTGAAAAAGAAGAGTTGGATGTTCCAC
AAGAAATATCACACGTGGTTCCGTAAAGCAGAGCCAGGTGAGCAAATTGCTAAAGGGCAA
CAACAAGGTAAATATATTTACTTTGACTATGAAACAACATGGAGTCAGAAGATAAGTCAG
AATTCAGATATCGATGAGACGTAATTCGAAAATGAATTATAAATAGATGAAAATTAAAAG
AATAGTCTAAACTCAGTTCAAATCTAGCCACTAGTGAAGAACCCAACCACCGCTTGA


>Contig21723.0.g24(protein)
MAKNQRKLQSELEKNLKAIDEGILQLETLEQKLNNAPAMSTKEKYEIEMKKEIKKLQRVR
DYFRAQINNSEIKDKSKLQDARRRVEIEMERFRAHEKEFKKKQFSKKALQAMNKDRNRDG
SGSDDGSDYGSNDCSDYDDDNSEIDYGDGDSDSQNDEDGNQSEEISEEMLNQLKLKDREF
FVEVLDFFKQQASKQEAELEVLRNKKVKGPPKKQKEKQVALSSKVAQVKKMRDRTEEIVN
NLEHIDLQQVKNLKSLLAQFMLIPESEEASCNSVKTQQIELEMARLMEIAEGSKKIQQSN
LQMQRDQLKAQEIRSKVDLDRHKDVIKDYCRVEQTQVGNILDAQDYLGNWHLAIVIKEKN
ARERDIHFLPYNNHKRDETFTDEDSNKIAPAFTNTEIPGEPDKSFTTLREYLGQLQKKLA
QQPPTQNVALEEKKVSQTAPSQQQQTAKPVAQQQPVQKTQQPLAQQNKKGEKVLKQKVSS
EEEEKISPSNQVQQTAAPILFGGNMFAGPDPFSQLMKQNQLQQQILGINQSPSLPVETID
TSLSNIASNILSTQQVPVQQSTSSTNVNSQFMDKTQQVLELLEASYRNIPQPQDQEVKEA
KHPVPLKEDNMFPTVPMFNRRENFSRFDLDTLFFAFYYQQGTYQQYLAAIELKKKSWMFH
KKYHTWFRKAEPGEQIAKGQQQGKYIYFDYETTWSQKISQNSDIDETQFENELQIDENQK
NSLNSVQIQPLVKNPTTA