Identifiers and Description

Gene Model Identifier

Contig709.1.g91

Standard Name

CNOT1b

Aliases

Contig709_1_g91

Description

AAA domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000707401.9994274381022833e-63CCR4-Not complex component, No
t1 family protein
SGDYCR093W0.000000000000004001928599951003CDC39 SGDID:S000000689, Chr II
I from 280117-286443, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig709.1.g91(coding)
ATGCAAAAAACCGTATCAACAAAGCAAACTGCTGCTCAGTAGCAGCAAAACTTGCCTGTC
TTCGAGAAGACCATCCAGTTTTCGCAAGCTCAAGCGATCGTGTGGCAGATCAAGTTCCTA
CTAAATTAGATCACTACCAAGAAAGCTCTGACGGCATCCTCAATCGAGCTAGATAATTTG
TCGAAATAGTTCGGAAAATGCTTCGATAAATATTTGCTTCGTGAGCTGATTGATTGGCTA
GACCTCAAAGATCCAGCCAAAGCCTAGACTGACAAAAATGAATAGTTCAAAGTCTAACTA
CTCAACTAAGAGCTGGTGAAGTCAATTCAAAAGCATGAATTCCTGTAGTACTTTGGGGAG
ATTGCACAACAAATATTTGGGGATAGAGTTAGTGAATTTCTGGCAGAGCTAACTAAAAGA
CTAAGATTAAATTTCTCAACTCAGCTTCTCATTGCTCTGTCAATATATGAGTCTTGCAGA
GAAGAAATCCAACATGATGCACTTAAATTACTTAAGTAAAAGTTGGTTGATTATCATAGT
TATGGCAAGCCTGAAATTCTACCAGAATACTCAGTTCACAAACTAATGTATCACTTGTCA
ACAAATTCTGAGCTTAACCAAGATGATACGATGAGAGATATTCAGCAGTATATTAAGGAC
AGTAATCCAATTAAAGCGGGATCCCATGTTTCACTGAGATCTGCTTTAATGCCAAACATT
ATGAATTCAAACGCAAGCCAAGATGACCCCTCTATAAGTCTCATAAAAGACGGAGTAGGT
TTAGACAACTTGGATAAATCCTACAAAATGCTTGAGCCTTGGCAAGTTCTAATCGAGATA
GGCCATTACTGCACCTACAACTATTCGTATCTTTTGAAAGTTCTTGAGGAATTCAAAGAA
ATGAATGAGTTGAGAATGGCAAAGACGCTTCTATATCTTTCTAAAAATCATGTTGGCACT
GAAGACTAACTAACAAGGATTGTGTATCAGACTTATGAAGCTTGTAAGAAAGGCGATTCT
TCTGGTCTTAACAAGGAGCCTAATGATAAGAAAACTTCAATGACATGGAGTGTGGACAAT
CTTGCTCGTGCCTTCAGAGAACTCTATTCAAACTTAAACTGGCTGAAAGTATTCGAAGCC
TTGACTGAAGTCTCAGCTGATGAAGAATGTACTCTAGATGACGCTAAGGCATTCCAAATG
TTTTTGCAACTCTTTAACAAGTGCAAACCCTAGAATGTCTCATTCCCTTTGAACATTGTG
CTCAACCATGACTGGAACAACACTCTGCTTCACATTGAATTCATCGAATACTCTATCTAG
AGCTATGTCGAAAAGAAAGATAAAACTATCAACTTTTAGAAGACTGAAAGAAAACAAGAA
CTTATCGAGGAGCTAAACAGCGTCAAAGAGAAAGTACCGATTGAATAAATTCATGTATGG
CTTTCTATTGAGTTAATTGAGAAATTGATTGTACTTTCTGACTCACATTATTTCACTAGA
GTCAGATAGGTTTTCGACTATCCCATCAAACACTTGCCTGAATACTTCATTCTCACTTTG
AGTCACTGCAAACCCAGAGCTGGTGGATTAATGATTGACGAATTGCTATCTCTACTCTTG
CCCCAATTCCTAGGCAATCACATCAATTCCATCCCAGTCCTCTAAAATCTTTGGAAGAAC
AACCAAGCTTTGATCATCAGAGGTATCTGCGAACTCTGTAGACATGACTAGAGAATCATG
AATTTATCTAGAGTCCTGGATATTACTCAAGAAGTCAGAGAGAGCTTAATGCCTATTGTG
AATTGTGATGACTACTACTTTGCTGTGAATCTTGGCATTTTAGCTGGAAAGAGAGATTTC
TTGCACTATGATCAATGGCTAGTTGATAGAATCAAAAACATTGGCACTCCTTTCATCAAG
GCGCTATTAAAATACATGAAGGAGCACATTCTTTCACCGATCTAAGAGTACATAAGGTCT
AAGAATCCCGCTGGGAATGTTTCAGATATCAATCCAGACCAGCTTGAAAACTAAAAAGTA
CAAATCTTAGATAGATCCCACTTAAGTAGGGAAAAACTTTGTCTTACTATTGAGCATTTA
AGCAGTTTAGTAAACAGGGCTAATCCAAAGATTTAAGAGTAAACACTCTCTTAGATTTCA
GAATTCATCAACAAAATTTCTGAATACTATCCTAACTAATTCACAAACCCTCAAAACTCT
GAAGAGATTGATAATGCTGCAAACGACTACTTCTAAAGAGTCTTTTAAGCAGAAACTTAC
CAGGTTGATCAAAAGATACAAGAACTGATTGAAACTATGCAAAAGTTCAAAGAATCTGAT
GTTAAGAAGGAACAAGAAATCTATGCATGCATGCTACATTCACTATTTGATGAGTACAGA
TTCTTACACAGATATCCTCAGCAATATCTTGAGAAAATTGCTAAACTCTACGGTGCAATC
ATTAAGAACAAAATAATCGATGGCACTCTGCAGGATATCGCATTGAAATTTGCATTTGAA
GCATTCAGAAGAGAGGGAAAGAGACAGAAGTTTGGTGTCATTACTATCAGACAGTTCTTT
GATATGCTTCCCTAATTCCCCAATTTCTTTGAAGAGATATATGAAAATAGACAAAGCATA
GCCTAGACTGATCCTTAAATGGTCAAAGATATTGAGGATCTATATGAAAGAACTCAGAAG
AAAGCTGACGAAATAAAAAGTCACCCAATTGTATAACAAGAGGATCACAAAAAGCAAAAT
GCTGATGCCGAAGATGCAAAAAATAAAAAAGAGGACAATAAAAAAGAATCTGCTGCAGAC
AAAAAGAAATTAGAAAAACCACCCTAATAACAAACTAATGCCACAAATGAGTTTATGGGA
CATCCACATGGCACCCAGAAACCCGGATAAGACAAAAACCAAAAAGGATAAGTTCAACAA
TAACCAATCGCAGAAGTTAGAACAACCACCCCTCTGGGTTCTAAGCCTGCTCCAATCTTT
GTACCTACTTCTAAGCAGGTACATAGCAAGTTAGAGCCAACTAAATCTATGCCCAACCCA
GCTGGAACTGGCACTTACATAGAGAACACGAATCTCAACGTAAAATCAGTGGAATTCAAA
AGAGTGACTACTGCTTAATAAGATACTGCTGCACTTGCTGGAACTGCCTCATAGTTAGGT
GTAACATAAAGCACAGATTTGAATACAAATCTGCCCACTTTCACCACTCAAGGGTCATTT
TAAAACACCCTACCAGCTTCTTAGTAGCTGGCACCTAGTTAAATAAGCATGTTGGGCAGT
AATGCTTTCAGACCTCAGAATGTCCGTAGTCCACCACCTCCCCAGACATTCCAAGTAAAT
CAATAAATAGTGCAAATGCAATAGTAGCTTGATCAAAGAATATAGAGGGCCATCACTGAA
AATGTCAAAGTGAGACTTGAAGATCTTATTGAAGACCCAAACATTGCACTACCCAAAGAG
GAGATTTAGGAACAAATCAAGTTCATTTGCAATAACACAGGTAAAACCAACTTTGCATAG
AAACTAGAGGAGCTGAAAACATCAGTATCATAAGATCCCTAAGTAAATATGAAATGGTTT
ATACATTACATATTGACTCGCAGAATATCTTAAGCTGCTAATATTCATCACTTATACATA
GAGATGATCAAACAATTAAACCCTAAGGAGTCAATCTCAAATGCTATAAGTCAGGCTGTA
GACTTATTCAAAAAGTGTCTACTTGTGGATAAAGAGAAGTTACTCCTAGTTGTCCAAAGA
ACTTAACATAGTGGCAGCTTGATCAACCAATATCTCAATAATCTTGGACAATTCCTAGGA
GGACTAACTGTTGCTGGTAACAGGCCAATTTATGCTAAAGAATTAGATATAAAGAAACTG
CTAGTTGAAGCATATGTTTCAGATAGATTGAGGCCAGTTGTTATATTTGTTAGCAAAATC
TTAAAAGAATGCCAAAACTCTGATTAYTTAAATTCAGAAGGNACAGAGACTATTATCTCA
GCTAGATCTATGGGTGAAATCAGAAGATACAATGAATTAATGGAGTTGTTAGATAAGAAT
CCAAATGCTAGATTGATGCTTAATAAGTAGGAAAAGTATAGAATAAATATCCCCTAAATT
TAAGAGAGCCCCACCCTGGAGTTATCAAACACGAGCATCAATAATAAGCAAAACAGCTCT
TTTGATAAGTAAATGGATGAGGATTTTGGTGAAGAAGTTATTCATTAGATTGAAAAAGTG
GAGTTGGAAAAGTACATATCTCATTAGAAAGCTATCGGTCATTCCAATTTAGACAAGAGC
AAACTTGAAATTCTAAACATGCAAAATGCTATCAATTTTAATGGAAAAGCACAGCATTAA
TACACGAAATTAGAGACAAGAGCACTTAACCATAAAAGCTCAAATCTTTTGCCGAAGCAC
TCAGTTCGTAGAAATCAAATGAAACCTTCGCTGGGTTAATAAATTACTAAGTAAAATACG
AACATGGAATGGGGAAAAATCCTGGTATAACACGAAGAGTGCAAATCCCCTGAAATCAGG
AAAAGTGGTTATTTCCAATAGAAAAACGACAATACCATTCATTTCGCCTACCTCTATGCA
TCTCCTTTAGTTGTGGATTTAGGTGGCGAAACTAAGGATGATGTGTTTGCAGATATAGGA
TTTAGAGAGGAATTTGATTAAATTGAAAACGCCTTAAAAGATGATAACACTCAGATCAGA
TACAGGTACCAACTAGCCACTTTATAGAACCTAAGTGAATGTTTGAGATAGCAGCCCTTA
GGTTTACATTTCTCTGGACACGGCCTTCAAAATCTGAAGGAAAAATTTAGAAACATTGCA
CCTATGAATTATCACACAACAATTTAGAATAAGGGGGATATTTTGGTGTTTGAAGAGACG
GATGGAGGCATCGCCTAGTTTTTATTTAAAGATGAACTTAAGAAAATATTGTTTTAGTAC
AAATCCGACTTGAAATTCGTAGTAGTAGCTTCATGTCATTCAGAAATGTGCGGAGAAGTA
TTTAAAGACTCTGGAGCTGAGCATGTAATTTGCATATAGCAAGATAAAGAAGTTAAAGAT
AGAGCAGCTATCACATTTTCTAGAGCGTTCTACATTAACGTCTTTTCTTCTCGAATGACT
ATATGTGAGGCATATTAAAATGCTGTTTTCTTGGTTGAGAAGGAATTTGGTAAAAAAGAA
GCTGCCATTTTTAAGCTAAAAACTTAGGATAATCATTAATGTGATGAAACATTCGCACTC
ATGGATGACTTACTTCCTGGTAAAATGGTTCCAATAATTAAGAAACCTAAGTTACTAATC
ATACCTTCAAATATAACCAAGTGGATTTCGAGAAACATGGAGACGTATGAAATTATCTAA
AAGCTTTTGTTTGATGGCGCTAAAATTGTCGAAGTTTTTGGGTTTTCAGGCGTTGGGAAA
TCTGCTATAATTACCAAAGTTGCGATTTATTTATCCGAACGACATATTTACAATGGAGGC
ATAATTTATGTGAACTGCTCAGGCATTGAAAAAGTCTAGGATGCATTTGCTTATTTAATA
TAAAAGCTTGATATTCATGTAGGAAAAAATGCTAAAAAGTTGGCATCTCTAAGCAAATTA
GGGGAAAAAGACTTGCTAAATAAAATATCCTAATTTACATTCAGTACCTAAAAGGTGTTA
TTCATTTTTGATAACATAGAGTAGATTATATATAACGACAGAGTGAAAATGGTAAATTCC
TTCAATTAGTTAGTGTGTGACAGAGATAACTTACAAATACTTTTTAGTACTTCTTTGTAT
GTTGGAGGCTTAGAAAGGTTTGTTGTGAAAAATTTAAAATCTTTGAATCCAAGAAAATCG
GCTGAATTGTTTTTAGCTAAAATCCCTTCTCAAGAAGCAAAGAATTAACTTCTTAACATT
GCTATGATGGGAAAGTTAGAGAGGATGACAAATGAATAAGAAAACTTCTCGAGAGCAGTT
GATCTTTTAAAATTGAGTGTCGCTTAAACATCATCTCTAATGAAGTTAAGGTTTTGTGAG
GATAGATGCACGAAAGGAACTCACAACAATGATATCGAGAAATGTGCTCTGGCTTACTTT
GAGAAACATCCCATGTTTCACATTTTAACAGAACCACTCTCTCTTTGTCTCGCTGCTTCT
TAATTACATTACTTGAATATTGCTTAACTATATGAGAAAATACTCAACAGTAAATTCTTA
GAGGAGAAGGATGATGCTTTGCTTATTAATATCATACAGGCGATTCAGGTTGCCAACTAG
CAATATGATTATAGTACTGAGCTACTTTTCATTATTGGTCAAACACCACAAGGTCTCTCA
TTTTCAGACATTTAAATAATATTTAAGGGAAAAACAGATATTGATGATGCTATATAGTTT
CTGTTAGACACATCCTTACTTGAAGTGGATAATTAGTCTTAATGTTATAATGTTTAGAAT
TTCGTAGCTAAATTTATAGAGCAGCAGTTATATGAGCAAAAAGAAATGAAAATTAAGTAT
AACATTAGACTTGCTAGTTTCTACATTGAAATTATCAACATGATGAAGCAGGAAGTGAGC
GATGATGAGAAAGATCTTCAAAGTCTCATCCAGGAATACAACTACTATGAGAAAAATATT
TTAGCTTGCATGACTTACTTACTATCAATTTGCTTTCCCCAAGATGACTAATTGAAAAAG
AGGAGGTAATCTTTCACTGGAAAACTATAATCTCTAGTTGCTAATAACGAGATATCTAAG
CAGTTGATGAAGTAGTTGACTTTAAAAGTTAAGAGTTAATTCGAGAATAAAAATTCAAGG
CGTTCTCAAAGAAAACTAAAGAATAGTGTAAGTAAAAATGATGTGGCTTATTTGAACATC
GCAGTTGACAAGGTCCTCAGGAAGTTTGTTTCACAAAAAAGCATTAAAGAATCATAAAAT
CATGACGATTTTCTTTGGATGGAAGATAGAGAAGAATTGAAAGTAGACTAAAATTAATAA
TAAAAAGACCAAGAAACATCGAATTTGAAAAAATTAAGGAGCAACATGAGCTATTTGGAG
GGCATGAAATCAGAAATCACTTCAAATTCTAATTCATCAGATTCTTCGTAGGAGCTTAGT
GAAGAAGAAAAATCAGGATCACAAACAGGGTTGAGTAGCTCTAGCCCAAATAATCTAACA
ATTAACTACTAATACAACAAAAAAACGTTAGACAATTAACAAGAATAGGAACAAATAACT
GAAAATTAAAACCAATCAGATTTAAGACAAATGCTGCCAAAGGTTTCTATTGGAAATTTA
GATGATTTTATCTAAAGCAGTATCATGAAAAAGTTATCTCTGTAGCTAAAGAATAGTAAT
TTCTAAAATGAAGAAGAGCTATTGCTGCCAGATCCCAATAATTTATAATCAATGAGAAGT
CACTCAAGCAATCATCATATTACGTTAAAGGTCACTGACGAATAAAATTAGGTTACTTAA
TAAATAAAGAAAGCATTTGCTTTAAACTTATCAAATAGCAGAGGAAATTTAAAGGTTGAC
GAAAACGAAGAGCAGAAGATTCAAACAAGCTAAAGATCTTCAAATAGAGGAATTAACTCA
GTTTTAAGCTAATATATTAGTAATGAGTTGAAGAAAATGAGTGATAAAGTTACAGACCAG
GAAAAGGCAAAGTATAAAAAGACACTTGGAAAATTTAAGCTTTTTGATAAAATGATCCAA
GCTAAGCCTTCAGAAGCATTAGCCTAATTTTTTAGCAATTAAATCAATGCCTGGTCTAAA
GATGATGAAGAGCATTAAAATTAAGAGAAGTCAATAGAAAATCAAAACATACAAATAAAT
GAAGCATCAGTTACAAATTAAATTATTATGCTAAGACATAAGAGATTGTTTCAAAAGGCT
AAGCAATAGTAAAATCTGAATATTAAAGATAACAACAATTAGGATTAAAAGTAGGAAGAT
CTATAGCCTCAGATTTCAAGCAATTAACTACTATCACCTAAGTCTGCAACTTCAAATTCA
AAAATACAGATAAACCAGGAGACTGATCAAAACGATAATTAACTGACTGATGAGGAACTT
TAGCATAAAATGATTTTGGGCTATTGCCAAACTCTACTGTTTCATTATCTGTCAATTTAA
GCTTTAAACAATACCGACCCTCATGAGCTTGAAAAACTAAATACAAAATATCACGTTGAC
GATATGGGCCCAATCTTTAAATCAAACATTGAGCTCCTCATGGTCTATTCACTTCTATCA
CGAGGAAAAGTAGAAAGCGCTTCTGTATATTTAGAAGGTATTGCCAAAACATTCAGGGAA
GAGAAATGCCTAAGAGGTTTAGGAATCTTCAACTTTTTTATGAGTTACATATTCCAGAAT
TTGAAAGTCAGGAATCACACTTAAATGGTGAAAACATGTTAAAAAGCATCAAATTACCTG
CAAAAAGGAGTTTAGTACTTCAAGAAATGCAATGATTTTTAGGGAATTGAATATTGCAAT
AATCTGAGAAAAATGATTGAGAAAGTGGATTTGAAAAAAGAAGTGAATCTAGCTTTTAAT
TCTAAAAGTTGCGTAGCATGA


>Contig709.1.g91(protein)
MQKTVSTKQTAAQQQQNLPVFEKTIQFSQAQAIVWQIKFLLNQITTKKALTASSIELDNL
SKQFGKCFDKYLLRELIDWLDLKDPAKAQTDKNEQFKVQLLNQELVKSIQKHEFLQYFGE
IAQQIFGDRVSEFLAELTKRLRLNFSTQLLIALSIYESCREEIQHDALKLLKQKLVDYHS
YGKPEILPEYSVHKLMYHLSTNSELNQDDTMRDIQQYIKDSNPIKAGSHVSLRSALMPNI
MNSNASQDDPSISLIKDGVGLDNLDKSYKMLEPWQVLIEIGHYCTYNYSYLLKVLEEFKE
MNELRMAKTLLYLSKNHVGTEDQLTRIVYQTYEACKKGDSSGLNKEPNDKKTSMTWSVDN
LARAFRELYSNLNWLKVFEALTEVSADEECTLDDAKAFQMFLQLFNKCKPQNVSFPLNIV
LNHDWNNTLLHIEFIEYSIQSYVEKKDKTINFQKTERKQELIEELNSVKEKVPIEQIHVW
LSIELIEKLIVLSDSHYFTRVRQVFDYPIKHLPEYFILTLSHCKPRAGGLMIDELLSLLL
PQFLGNHINSIPVLQNLWKNNQALIIRGICELCRHDQRIMNLSRVLDITQEVRESLMPIV
NCDDYYFAVNLGILAGKRDFLHYDQWLVDRIKNIGTPFIKALLKYMKEHILSPIQEYIRS
KNPAGNVSDINPDQLENQKVQILDRSHLSREKLCLTIEHLSSLVNRANPKIQEQTLSQIS
EFINKISEYYPNQFTNPQNSEEIDNAANDYFQRVFQAETYQVDQKIQELIETMQKFKESD
VKKEQEIYACMLHSLFDEYRFLHRYPQQYLEKIAKLYGAIIKNKIIDGTLQDIALKFAFE
AFRREGKRQKFGVITIRQFFDMLPQFPNFFEEIYENRQSIAQTDPQMVKDIEDLYERTQK
KADEIKSHPIVQQEDHKKQNADAEDAKNKKEDNKKESAADKKKLEKPPQQQTNATNEFMG
HPHGTQKPGQDKNQKGQVQQQPIAEVRTTTPLGSKPAPIFVPTSKQVHSKLEPTKSMPNP
AGTGTYIENTNLNVKSVEFKRVTTAQQDTAALAGTASQLGVTQSTDLNTNLPTFTTQGSF
QNTLPASQQLAPSQISMLGSNAFRPQNVRSPPPPQTFQVNQQIVQMQQQLDQRIQRAITE
NVKVRLEDLIEDPNIALPKEEIQEQIKFICNNTGKTNFAQKLEELKTSVSQDPQVNMKWF
IHYILTRRISQAANIHHLYIEMIKQLNPKESISNAISQAVDLFKKCLLVDKEKLLLVVQR
TQHSGSLINQYLNNLGQFLGGLTVAGNRPIYAKELDIKKLLVEAYVSDRLRPVVIFVSKI
LKECQNSDXLNSEXTETIISARSMGEIRRYNELMELLDKNPNARLMLNKQEKYRINIPQI
QESPTLELSNTSINNKQNSSFDKQMDEDFGEEVIHQIEKVELEKYISHQKAIGHSNLDKS
KLEILNMQNAINFNGKAQHQYTKLETRALNHKSSNLLPKHSVRRNQMKPSLGQQITKQNT
NMEWGKILVQHEECKSPEIRKSGYFQQKNDNTIHFAYLYASPLVVDLGGETKDDVFADIG
FREEFDQIENALKDDNTQIRYRYQLATLQNLSECLRQQPLGLHFSGHGLQNLKEKFRNIA
PMNYHTTIQNKGDILVFEETDGGIAQFLFKDELKKILFQYKSDLKFVVVASCHSEMCGEV
FKDSGAEHVICIQQDKEVKDRAAITFSRAFYINVFSSRMTICEAYQNAVFLVEKEFGKKE
AAIFKLKTQDNHQCDETFALMDDLLPGKMVPIIKKPKLLIIPSNITKWISRNMETYEIIQ
KLLFDGAKIVEVFGFSGVGKSAIITKVAIYLSERHIYNGGIIYVNCSGIEKVQDAFAYLI
QKLDIHVGKNAKKLASLSKLGEKDLLNKISQFTFSTQKVLFIFDNIEQIIYNDRVKMVNS
FNQLVCDRDNLQILFSTSLYVGGLERFVVKNLKSLNPRKSAELFLAKIPSQEAKNQLLNI
AMMGKLERMTNEQENFSRAVDLLKLSVAQTSSLMKLRFCEDRCTKGTHNNDIEKCALAYF
EKHPMFHILTEPLSLCLAASQLHYLNIAQLYEKILNSKFLEEKDDALLINIIQAIQVANQ
QYDYSTELLFIIGQTPQGLSFSDIQIIFKGKTDIDDAIQFLLDTSLLEVDNQSQCYNVQN
FVAKFIEQQLYEQKEMKIKYNIRLASFYIEIINMMKQEVSDDEKDLQSLIQEYNYYEKNI
LACMTYLLSICFPQDDQLKKRRQSFTGKLQSLVANNEISKQLMKQLTLKVKSQFENKNSR
RSQRKLKNSVSKNDVAYLNIAVDKVLRKFVSQKSIKESQNHDDFLWMEDREELKVDQNQQ
QKDQETSNLKKLRSNMSYLEGMKSEITSNSNSSDSSQELSEEEKSGSQTGLSSSSPNNLT
INYQYNKKTLDNQQEQEQITENQNQSDLRQMLPKVSIGNLDDFIQSSIMKKLSLQLKNSN
FQNEEELLLPDPNNLQSMRSHSSNHHITLKVTDEQNQVTQQIKKAFALNLSNSRGNLKVD
ENEEQKIQTSQRSSNRGINSVLSQYISNELKKMSDKVTDQEKAKYKKTLGKFKLFDKMIQ
AKPSEALAQFFSNQINAWSKDDEEHQNQEKSIENQNIQINEASVTNQIIMLRHKRLFQKA
KQQQNLNIKDNNNQDQKQEDLQPQISSNQLLSPKSATSNSKIQINQETDQNDNQLTDEEL
QHKMILGYCQTLLFHYLSIQALNNTDPHELEKLNTKYHVDDMGPIFKSNIELLMVYSLLS
RGKVESASVYLEGIAKTFREEKCLRGLGIFNFFMSYIFQNLKVRNHTQMVKTCQKASNYL
QKGVQYFKKCNDFQGIEYCNNLRKMIEKVDLKKEVNLAFNSKSCVA