Identifiers and Description

Gene Model Identifier

Contig14324.0.g26

Standard Name

CNOT1a

Aliases

Contig14324_0_g26

Description

CCR4-Not complex component, Not1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam04054 ) CCR4-Not complex component, Not1
  • ( pfam12842 ) Domain of unknown function (DUF3819)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000707409.001992589090134e-64CCR4-Not complex component, No
t1 family protein
SGDYCR093W7.999697430377842e-40CDC39 SGDID:S000000689, Chr II
I from 280117-286443, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14324.0.g26(coding)
ATGCAAAAAACCGTATCAACAAAGCAAACTGCTGCTCAGTAGCAGCAAAACTTGCCTGTC
TTCGAGAAGACCATCCAGTTTTCGCAAGCTCAAGCGATCGTGTGGCAGATCAAGTTCCTA
CTAAATTAGATCACTACCAAGAAAGCTCTGACGGCATCCTCAATCGAGCTAGATAATTTG
TCGAAATAGTTCGGAAAATGCTTCGATAAATATTTGCTTCGTGAGCTGATTGATTGGCTA
GACCTCAAAGATCCAGCCAAAGCCTAGACTGACAAAAATGAATAGTTCAAAGTCTAACTA
CTCAACTAAGAGCTGGTGAAGTCAATTCAAAAGCATGAATTCCTGTAGTACTTTGGGGAG
ATTGCACAACAAATATTTGGGGATAGAGTTAGTGAATTTCTGGCAGAGCTAACTAAAAGA
CTAAGATTAAATTTCTCAACTCAGCTTCTCATTGCTCTGTCAATATATGAGTCTTGCAGA
GAAGAAATCCAACATGATGCACTTAAATTACTTAAGTAAAAGTTGGTTGATTATCATAGT
TATGGCAAGCCTGAAATTCTACCAGAATACTCAGTTCACAAACTAATGTATCACTTGTCA
ACAAATTCTGAGCTTAACCAAGATGATACGATGAGAGATATTCAGCAGTATATTAAGGAC
AGTAATCCAATTAAAGCGGGATCCCATGTTTCACTGAGATCTGCTTTAATGCCAAACATT
ATGAATTCAAACGCAAGCCAAGATGACCCCTCTATAAGTCTCATAAAAGACGGAGTAGGT
TTAGACAACTTGGATAAATCCTACAAAATGCTTGAGCCTTGGCAAGTTCTAATCGAGATA
GGCCATTACTGCACCTACAACTATTCGTATCTTTTGAAAGTTCTTGAGGAATTCAAAGAA
ATGAATGAGTTGAGAATGGCAAAGACGCTTCTATATCTTTCTAAAAATCATGTTGGCACT
GAAGACTAACTAACAAGGATTGTGTATCAGACTTATGAAGCTTGTAAGAAAGGCGATTCT
TCTGGTCTTAACAAGGAGCCTAATGATAAGAAAACTTCAATGACATGGAGTGTGGACAAT
CTTGCTCGTGCCTTCAGAGAACTCTATTCAAACTTAAACTGGCTGAAAGTATTCGAAGCC
TTGACTGAAGTCTCAGCTGATGAAGAATGTACTCTAGATGACGCTAAGGCATTCCAAATG
TTTTTGCAACTCTTTAACAAGTGCAAACCCTAGAATGTCTCATTCCCTTTGAACATTGTG
CTCAACCATGACTGGAACAACACTCTGCTTCACATTGAATTCATCGAATACTCTATCTAG
AGCTATGTCGAAAAGAAAGATAAAACTATCAACTTTTAGAAGACTGAAAGAAAACAAGAA
CTTATCGAGGAGCTAAACAGCGTCAAAGAGAAAGTACCGATTGAATAAATTCATGTATGG
CTTTCTATTGAGTTAATTGAGAAATTGATTGTACTTTCTGACTCACATTATTTCACTAGA
GTCAGATAGGTTTTCGACTATCCCATCAAACACTTGCCTGAATACTTCATTCTCACTTTG
AGTCACTGCAAACCCAGAGCTGGTGGATTAATGATTGACGAATTGCTATCTCTACTCTTG
CCCCAATTCCTAGGCAATCACATCAATTCCATCCCAGTCCTCTAAAATCTTTGGAAGAAC
AACCAAGCTTTGATCATCAGAGGTATCTGCGAACTCTGTAGACATGACTAGAGAATCATG
AATTTATCTAGAGTCCTGGATATTACTCAAGAAGTCAGAGAGAGCTTAATGCCTATTGTG
AATTGTGATGACTACTACTTTGCTGTGAATCTTGGCATTTTAGCTGGAAAGAGAGATTTC
TTGCACTATGATCAATGGCTAGTTGATAGAATCAAAAACATTGGCACTCCTTTCATCAAG
GCGCTATTAAAATACATGAAGGAGCACATTCTTTCACCGATCTAAGAGTACATAAGGTCT
AAGAATCCCGCTGGGAATGTTTCAGATATCAATCCAGACCAGCTTGAAAACTAAAAAGTA
CAAATCTTAGATAGATCCCACTTAAGTAGGGAAAAACTTTGTCTTACTATTGAGCATTTA
AGCAGTTTAGTAAACAGGGCTAATCCAAAGATTTAAGAGTAAACACTCTCTTAGATTTCA
GAATTCATCAACAAAATTTCTGAATACTATCCTAACTAATTCACAAACCCTCAAAACTCT
GAAGAGATTGATAATGCTGCAAACGACTACTTCTAAAGAGTCTTTTAAGCAGAAACTTAC
CAGGTTGATCAAAAGATACAAGAACTGATTGAAACTATGCAAAAGTTCAAAGAATCTGAT
GTTAAGAAGGAACAAGAAATCTATGCATGCATGCTACATTCACTATTTGATGAGTACAGA
TTCTTACACAGATATCCTCAGCAATATCTTGAGAAAATTGCTAAACTCTACGGTGCAATC
ATTAAGAACAAAATAATCGATGGCACTCTGCAGGATATCGCATTGAAATTTGCATTTGAA
GCATTCAGAAGAGAGGGAAAGAGACAGAAGTTTGGTGTCATTACTATCAGACAGTTCTTT
GATATGCTTCCCTAATTCCCCAATTTCTTTGAAGAGATATATGAAAATAGACAAAGCATA
GCCTAGACTGATCCTTAAATGGTCAAAGATATTGAGGATCTATATGAAAGAACTCAGAAG
AAAGCTGACGAAATAAAAAGTCACCCAATTGTATAACAAGAGGATCACAAAAAGCAAAAT
GCTGATGCCGAAGATGCAAAAAATAAAAAAGAGGACAATAAAAAAGAATCTGCTGCAGAC
AAAAAGAAATTAGAAAAACCACCCTAATAACAAACTAATGCCACAAATGAGTTTATGGGA
CATCCACATGGCACCCAGAAACCCGGATAAGACAAAAACCAAAAAGGATAAGTTCAACAA
TAACCAATCGCAGAAGTTAGAACAACCACCCCTCTGGGTTCTAAGCCTGCTCCAATCTTT
GTACCTACTTCTAAGCAGGTACATAGCAAGTTAGAGCCAACTAAATCTATGCCCAACCCA
GCTGGAACTGGCACTTACATAGAGAACACGAATCTCAACGTAAAATCAGTGGAATTCAAA
AGAGTGACTACTGCTTAATAAGATACTGCTGCACTTGCTGGAACTGCCTCATAGTTAGGT
GTAACATAAAGCACAGATTTGAATACAAATCTGCCCACTTTCACCACTCAAGGGTCATTT
TAAAACACCCTACCAGCTTCTTAGTAGCTGGCACCTAGTTAAATAAGCATGTTGGGCAGT
AATGCTTTCAGACCTCAGAATGTCCGTAGTCCACCACCTCCCCAGACATTCCAAGTAAAT
CAATAAATAGTGCAAATGCAATAGTAGCTTGATCAAAGAATATAGAGGGCCATCACTGAA
AATGTCAAAGTGAGACTTGAAGATCTTATTGAAGACCCAAACATTGCACTACCCAAAGAG
GAGATTTAGGAACAAATCAAGTTCATTTGCAATAACACAGGTAAAACCAACTTTGCATAG
AAACTAGAGGAGCTGAAAACATCAGTATCATAAGATCCCTAAGTAAATATGAAATGGTTT
ATACATTACATATTGACTCGCAGAATATCTTAAGCTGCTAATATTCATCACTTATACATA
GAGATGATCAAACAATTAAACCCTAAGGAGTCAATCTCAAATGCTATAAGTCAGGCTGTA
GACTTATTCAAAAAGTGTCTACTTGTGGATAAAGAGAAGTTACTCCTAGTTGTCCAAAGA
ACTTAACATAGTGGCAGCTTGATCAACCAATATCTCAATAATCTTGGACAATTCCTAGGA
GGACTAACTGTTGCTGGTAACAGGCCAATTTATGCTAAAGAATTAGATATAAAGAAACTG
CTAGTTGAAGCATATGTTTCAGATAGATTGAGGCCAGTTGTTATATTTGTTAGCAAAATC
TTAAAAGAATGCCAAAAGTCAAGCATATTTAAACCCCAAAACCCTTGGATCAAGGCTAAT
CTAGAAATCTTAAGAGAGATTTATGAATTACATCAGTAAGCAATTGCTCAGAAAGATGAC
ACAATTTTAGAAATAGAGTCACTCTTTAGGACAATGGGAATCCAAAATGTTACAGATATT
AAGCATTAAGGCTTCCTAAAAGCATCAATAACTAGATAATTTATATCTCAATCTCAACAA
GTTGAGTATAGCCACTTGATTAACAAATCTTCTCTCATACCACCTCCACCAGCACTCTTC
TAAAACTAGCAGCAAATCCCAATGAGAAATCAAAGTGCTTCACCTTCACCAAATCTCTTT
TTACCACAATCTAGCGGGCTATTCCCAGTTAATGGCCAAGCTTAAAATGCTGAACTAAAT
CTTTTACTGTAGCAGTAATAAGAAATTCATCCTAGAGTAATTGTCTCCCCTGAGTTTATG
CAACACTTCTCATGGCTTGGGCCAGAATGTGAGGCAAAACTAAGAACTATAGTGGGAAAA
GCTGTAGATTCATCTATTGTGGAAATATTACCACCAGTAGTTGATAGATCTGTAACAATT
GCTCTGATCACAACCAGAGAGCTTGTGCTTAAAGATTTTGCATTCGATAGTGATCAAAAC
AAAATATTAAGAGCTGCTGACTTAATAGTGCAGAACTTAGCTGGATCCCTCGCTCTTGTT
ACTTGCAGAGAACCCCTTAAAATGTCTCTAACTACAAACTTAAAGAAGTCAATTCAATAA
CTTATCGTAGAGACCAACCCAGAGAAAGCTGAATAAATGAATGAAAACTTCATCTCAGAT
ATTTCATCAATAGCTAGCAGAGAAAACCTTGAACTTGGTTGCAAACTTATTAACAAATCA
GTTGTCTAAAAAGCTCTTACTAGAGTGAGAGAAGATCTTTAAATAAGATCAGCTATTGAA
AGAAGAAAGCAATCTCAAGGTAGACCAGGACCATTTTTAGTTGATGATAATATGGCTTAA
CAATTTGCTGAGTTGCCACCCTAACTTAAACCAAATTCAATGGGACTTACCGAATCACAA
TTCTAGGTCTATGAAGATTTCTAGAGATAAAACAGATCAGCAAGAAGATAAGATTCATTA
TAAGAAGGTAGCAGAGCAGCACAAATCAGTGAATCTAGCGTAAGTGATATCGAAAGCTTG
TTAAGAGCTCTTGAAAGACTACCAGCTTTGGATGAAGTTATGAAGCATCAATTAAGTTAG
AAACTAGCTCTATTATCTTAAGAGCAGGACTAAGAGGAGATTCAGAAACTTTGGTTATTC
TGCCAAAGACTGTTTTTAGCTTCATGTGAGAAATTCATTTAAACAAACGATATTGACCAA
GTTTCTGGACCTTTAGAAAGCTTAAATTTCATTGTTAAAAGCTTCAAGATTGAGGACTTT
TAGAAGTAATTGACTACTATTTTCTTGGAGTCTAATGATATCTACCCTAACAATATCAAT
CTTACTGTAATCCTCATGAAAAACAGCATTATTTCAGTATCAGAGTGGGACTCAAACATT
GCTAGTCATTTAAGAGAATACATGTAATTCCAGCAACCAGATATTTTCATGAACTTTATC
ATAAACTTCATCTAGTAAGCCATTATTTAGGAGAAGATCTTCAACTAAGGTCAGTTCCCA
AATATGATGTCTGTTATCGAAAAGCTATCTGAACAAAAGAGTCTATCAAAAGTCCTTAAT
CCAATTATTGAGGCATTAAAAGCAAAGTTAGTCTGGAACAAGGACAAACTTAAAGGGTAC
ATACTCTAATGGGCTTAAATTTCCTTTGAAGAGAATAATTAAAAGCAAGAGTAGGAAATC
AACAAATTCTTCCATAATCTTTCAGAAATTGGGTTCTATAAGGATTCAGAAATTATGTAC
AACTTCTGCAAGGTAATGGTTGAAATATCAATCGAAAGAGCTCTTTTCATGCAAAATGGA
ACTAAAAGACCAAGTGATAGATTAGACTATAGATATATCGAAAGTTTCTTGAAACTTATG
GTTGTGTTATTAAAAACTTCAGAAATAAATAAGCATGAATTTATGTCAAAGCTTTTTGAA
GCTATTTAAGGAGTCTTAGATGAAGATCACAAATCAAAGAAATCAGAGTTCAATTAGAAA
CCTTACTATAGACTGCTTATCAATATACTAACTGCTGTCAATAACTTGCAATTCATTAAC
CCAAAGACTCATTTGCTTATTCTTTTCAGTTTGGCTGATCTCTTTAGTAAACTGAACCCA
AATAAATATCCAGCCTTCTCATTCGCTTGGTTAGAACTTATCTCTCACAAATAGTTCATG
CCGCATTTCCTAGCTTTCTAGAATAACTAACCACTCTAATAATATATGGACAATCTATAT
TAATCTTAAAATTAAAGAGGGCAATCCCAAGCTTCATCATAATAGGCTGCTGATAATACT
TTCTATTAGAAATGGTTTAAGTTCAAGGAACTTATTGTAAATCTATTTACCTTCTTGAAG
AATAATATGATCCCAGGCTAACCACTATCGGACCCACTAGTAAAGTACTATGAAGCCACC
TTGAGAGTTGTACTCGTTATCAGACATGACTTCCCAGAATTTTTGTGCGACTTCTACTTT
AACTTTGTCAACAGTTTGCCTGAACATTGTATCTAACTTAGAAATATCATTCTATCTGCC
AATCCTAAGAGTGTTCCATATCACAATCCTTTCAGCAAAAACCTCAAGGTTGATCAAATC
AAGGAAATTTACAACAAACCTAGAATGCTTTCAATGAGCTACGATAGTTAGACCCATAGT
ATCTATGAAAATTAAGATGCTGGCTTCAATGATCACCAAGTCTACCTTGCTATTATGAAC
TTGAGAGAGGATCTTGAAAAGTACTTCAGAACCAAGAGTTCAAACCTTATTCAAGTTATT
TGCGATAAACTTATGCAATCTGAAGAGATCCTGAATGGCAGACGTAAAATTAACTCAAAT
ATCATTAATGCAGTTGTTTTGTTCATTGGCAATCATACCATCTAGAAGAACTCTCCTGAC
TTCAAAGAAAAAGAGTGCTATGAGATGTACAAGAAAATCATATAAAGTTTGAATAATGAG
ACTAGATCTTGCTTCCTCAATTGCCTCGTAAATGAACTCAGATACATCAATAGTCAAACT
TATTTCTATTCTTGGATTGTGCTCTATCTATTCTCAGACATTGAAGAAAAAATCCAGGAG
TAAATAACCCGAATTCTTATTGAAAGATTGCAAGTACATGAACCTTACCCATGGGGATTG
TGTATTACCTTCCGTGAGCTCCTTCAAAACCCCAAGTACAACTTCCTAAAGAAATCATTT
GTGTTGCAGAACATGGAAATGTTTGAACAGCTATTCCAAACAAGGCTACAACCTCTCCTT
CCCACATGGTAGAGCAAACGAGTGAGCGATCAGTAACTTCTTGACTAACAGTAAATGTAA
CAACAACAGCAAAATCAATCACAACAATAACTAAACACTGCCAGCTAGTAATGA


>Contig14324.0.g26(protein)
MQKTVSTKQTAAQQQQNLPVFEKTIQFSQAQAIVWQIKFLLNQITTKKALTASSIELDNL
SKQFGKCFDKYLLRELIDWLDLKDPAKAQTDKNEQFKVQLLNQELVKSIQKHEFLQYFGE
IAQQIFGDRVSEFLAELTKRLRLNFSTQLLIALSIYESCREEIQHDALKLLKQKLVDYHS
YGKPEILPEYSVHKLMYHLSTNSELNQDDTMRDIQQYIKDSNPIKAGSHVSLRSALMPNI
MNSNASQDDPSISLIKDGVGLDNLDKSYKMLEPWQVLIEIGHYCTYNYSYLLKVLEEFKE
MNELRMAKTLLYLSKNHVGTEDQLTRIVYQTYEACKKGDSSGLNKEPNDKKTSMTWSVDN
LARAFRELYSNLNWLKVFEALTEVSADEECTLDDAKAFQMFLQLFNKCKPQNVSFPLNIV
LNHDWNNTLLHIEFIEYSIQSYVEKKDKTINFQKTERKQELIEELNSVKEKVPIEQIHVW
LSIELIEKLIVLSDSHYFTRVRQVFDYPIKHLPEYFILTLSHCKPRAGGLMIDELLSLLL
PQFLGNHINSIPVLQNLWKNNQALIIRGICELCRHDQRIMNLSRVLDITQEVRESLMPIV
NCDDYYFAVNLGILAGKRDFLHYDQWLVDRIKNIGTPFIKALLKYMKEHILSPIQEYIRS
KNPAGNVSDINPDQLENQKVQILDRSHLSREKLCLTIEHLSSLVNRANPKIQEQTLSQIS
EFINKISEYYPNQFTNPQNSEEIDNAANDYFQRVFQAETYQVDQKIQELIETMQKFKESD
VKKEQEIYACMLHSLFDEYRFLHRYPQQYLEKIAKLYGAIIKNKIIDGTLQDIALKFAFE
AFRREGKRQKFGVITIRQFFDMLPQFPNFFEEIYENRQSIAQTDPQMVKDIEDLYERTQK
KADEIKSHPIVQQEDHKKQNADAEDAKNKKEDNKKESAADKKKLEKPPQQQTNATNEFMG
HPHGTQKPGQDKNQKGQVQQQPIAEVRTTTPLGSKPAPIFVPTSKQVHSKLEPTKSMPNP
AGTGTYIENTNLNVKSVEFKRVTTAQQDTAALAGTASQLGVTQSTDLNTNLPTFTTQGSF
QNTLPASQQLAPSQISMLGSNAFRPQNVRSPPPPQTFQVNQQIVQMQQQLDQRIQRAITE
NVKVRLEDLIEDPNIALPKEEIQEQIKFICNNTGKTNFAQKLEELKTSVSQDPQVNMKWF
IHYILTRRISQAANIHHLYIEMIKQLNPKESISNAISQAVDLFKKCLLVDKEKLLLVVQR
TQHSGSLINQYLNNLGQFLGGLTVAGNRPIYAKELDIKKLLVEAYVSDRLRPVVIFVSKI
LKECQKSSIFKPQNPWIKANLEILREIYELHQQAIAQKDDTILEIESLFRTMGIQNVTDI
KHQGFLKASITRQFISQSQQVEYSHLINKSSLIPPPPALFQNQQQIPMRNQSASPSPNLF
LPQSSGLFPVNGQAQNAELNLLLQQQQEIHPRVIVSPEFMQHFSWLGPECEAKLRTIVGK
AVDSSIVEILPPVVDRSVTIALITTRELVLKDFAFDSDQNKILRAADLIVQNLAGSLALV
TCREPLKMSLTTNLKKSIQQLIVETNPEKAEQMNENFISDISSIASRENLELGCKLINKS
VVQKALTRVREDLQIRSAIERRKQSQGRPGPFLVDDNMAQQFAELPPQLKPNSMGLTESQ
FQVYEDFQRQNRSARRQDSLQEGSRAAQISESSVSDIESLLRALERLPALDEVMKHQLSQ
KLALLSQEQDQEEIQKLWLFCQRLFLASCEKFIQTNDIDQVSGPLESLNFIVKSFKIEDF
QKQLTTIFLESNDIYPNNINLTVILMKNSIISVSEWDSNIASHLREYMQFQQPDIFMNFI
INFIQQAIIQEKIFNQGQFPNMMSVIEKLSEQKSLSKVLNPIIEALKAKLVWNKDKLKGY
ILQWAQISFEENNQKQEQEINKFFHNLSEIGFYKDSEIMYNFCKVMVEISIERALFMQNG
TKRPSDRLDYRYIESFLKLMVVLLKTSEINKHEFMSKLFEAIQGVLDEDHKSKKSEFNQK
PYYRLLINILTAVNNLQFINPKTHLLILFSLADLFSKLNPNKYPAFSFAWLELISHKQFM
PHFLAFQNNQPLQQYMDNLYQSQNQRGQSQASSQQAADNTFYQKWFKFKELIVNLFTFLK
NNMIPGQPLSDPLVKYYEATLRVVLVIRHDFPEFLCDFYFNFVNSLPEHCIQLRNIILSA
NPKSVPYHNPFSKNLKVDQIKEIYNKPRMLSMSYDSQTHSIYENQDAGFNDHQVYLAIMN
LREDLEKYFRTKSSNLIQVICDKLMQSEEILNGRRKINSNIINAVVLFIGNHTIQKNSPD
FKEKECYEMYKKIIQSLNNETRSCFLNCLVNELRYINSQTYFYSWIVLYLFSDIEEKIQE
QITRILIERLQVHEPYPWGLCITFRELLQNPKYNFLKKSFVLQNMEMFEQLFQTRLQPLL
PTWQSKRVSDQQLLDQQQMQQQQQNQSQQQLNTASQQ