Identifiers and Description

Gene Model Identifier

Contig20200.0.g58

Standard Name

CNOT10

Aliases

Contig20200_0_g58

Description

TPR repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006376600.000000000500206551404915TPR Domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20200.0.g58(coding)
ATGTCTTCCGATATCAACGTAATGTTGGGAAATATTGAAGCAGGATCCCCAGAAGATCTT
TCAATGAAATCTTTTGAAGCTTATCAAAAGTCAAACTTTAAAGAAACTTAAAAATTACTT
GATAAGTTAAAGAGTGGTTTAGATGAAAAAGATTCGCGTTATTAGTAGAATGTTCTCATC
ACTTAATATTATGCGGAAAAGTGCAAATTCCCTTAGAAATATTTGAATGATCTCACAAAC
CTTGCTACTGATATGGTATAAATAACTAAAGCACCAAACTGTTCCATTAAGCAAGTAACT
GAAAATGGAGTGACTTAAAACTTAATTTAAATTGGAAATCAATATCAAATTCCTGCAAAT
TTGGCGCAGCAGTATTAATAAGCATCAGATTAACTCTAAGGCTAAAATCCAGGAGGATAG
TCTATAGGAGCAGGAGTAGGCTCATAACAAAATTAAACTTTTCAATAAAGAGCTGGAGTT
TAAGGCTAAGTTGGAAAGTCGAGCAATTTGAGTATTGATGGTTAGCAAATCTTCTAACTG
AGTGTTAATGAAGTAAATCCAGTACTTTTATATAATATTGCAGCTATGAGCTATTAATTA
CAGCAGTATGGAAAGTCCTTGAGCTATTTAATTGAAATAATTAAGAATCTTGAGCAAGTA
GAAGAATTCTTAATGATTAAAAGCATGTTCTTGATGCTACAAATTTTGTACGAATTGAAA
TAAAATGAGTCTGCGTGGCCCATTATTTATTACTTGAAAGTCAAGTTAAGAGAATTTTAA
TAGACTATTCAGTAGAAATAGCTTATTAGAAGCTAAACAGAGGAAGAAATCAAATCCCAT
AACTCGACATAAGAGGAATCTAAAAGTGATATGAGCGAGGAATTTTTAGATGTAAACGTC
CTAAATAAGAATAGCTTTTGCATCATAAATACTTCATATTTAAGAAAGCATGCAATTTCT
CCAAAAAATATGAATATTCATGAATATATGTTCCTTCTGAAAAGTTTTACTTCTTTGTTC
CTTCTTTAACAAGGGGATGTTGAAGGTGCTTAACTTGAGCTAAAATCAGCTGGTGAGTTC
AAAGACAAATATGGCTAAGATCCTGTAAAGGTAAAGTCATAAATTAATGTCTTAGCTATG
GTGTAGCATCTTGGAATGGTTAATAGCTTAAAAGCCTAGATTCACTTGAAAGAAGGAAAT
TTCTTAAAAAGCATCAAGACGTTGACTCTAGATGAAAAGGCTAGCAACAGTCCACATCCA
TCATGCAACTTTATCAAACTTTAAGATGAGAACTCAAAAGCAGATTCAGTTTACTAAAAG
TGCCAAAACTCCTTCCCTCACTACTACTTCAACAACCTAGGGATTATTCATTTAAAGCTT
CAAAAGTATAGCTTAGCCATCTTTTATTTCTCAAAAGCTCTTAAATATGTTGAAAAGAGC
CAGAATGGTCAACCATCTCTTTAAAACGACAGTGATAATCCAAATGAGCATATTAGTCAC
CTAAATACTTAGAAAATATCAGAGATACTCTATAACTATGGCATTGCTCTATTCAAAGTC
GGAAAGTTTGAGGAAGCATTCAGAAGCTTTGAAAAGGCATCTCATTCATTGAGACACCAT
CCAAGATTATGGTACTACATGGGTCAAGCAAGTCTATCACTCAACCAATAATTATATCAA
GAATCATTGAGCTCTTAATATCAATCAGATGTGTTCTATAAAGCAATGGGATTTGGCGAA
CCAAGTTACACTAAAGTAAACTCACAACAACAGCATAAAAGATTTATCTTAACATAAACC
GGGGATTCACTATAAAATCTTGAGTCAGCAATGACTTCACACGACTAAACTCAATTTGAA
AAATTGAAGCAACAACAATAAGAGATCCTGAAATCTCAAAGTCAAGGTTATATTCAAAAG
CAAACCAAAGCTCAACAAAAGAAAGAGAAATTAGCTCAATAGCAAAAGCAAAATTAGATA
AACATGCCACCAGAATCAATGAGCTTATAGAGTGCTATTATGTACTTTCAAAATGCCCTA
ATTGGTATCGAAGAGCATAAGCAAAATGAGATCAACTATTCACTATACATCAGATTCCTG
TTAAGATAGCAACATCTTAATAGCGTGATAACAGCAAATAATGAAAGAATTTAAGTTGGT
CACTTCAGCGTGGGTGTTAGTCAAAATCTTCCAGATTCTATCAATGCATCATTTGAACCT
CAGAACCTCAATGAATCTGAAGACATTTAATACTTGACTGAGTATCCATAATCATAGTAG
GATTTAATTGCTTATAAACAATAAATCAGACAGCAAGTGGACAAGAAGTACGAAACATTA
AAAAAGAACATCTTGATGCACCTTTGTTACGCATAATTACTCTCAAATGATTTCCAGAGT
GCTATCAAAACTGGCAACAATATTCTAAGAAACTTGAACCCAAACGCCTAGACAAAGTTT
ATTGTGATGCAATATTTGGCTGAAGCTTACACAATGATGGGATAGACCCAACAAGCTTTG
GATTGCTTGAAAGTAGAGAATTAACTTGACCCAGAAGTTAAATTAAAATTTGACAATGTT
GCCTCGAACATTAGAGAAGAAAAATCCTCTCTCAACTCTTCTATTATTCAGACAATCAAC
ATCAGCGCTATCAATATTTGTGCTGGAGATATGGATCAAGCCAAGGCAACATTTGATTAA
GCCCTAGAAGCACTTGAACTAAAGTTGCAAACTACTGAAATGGAAAGCAAAAATCTCTTG
CCATCCTACTTAGTTAACTTACTCGTTTACTTCTATATCAAGGCCAAAAACTTCAAAATG
GCCAGACAATTACTTAAGAGTAGAAGATACGTCCTGGATACTGGTCACATCGAGACTGCT
TAAACAGGGCAAATTTCACAAGCTCAAAAATCAAGAAACAAGTCAAAGACCTTGATTAGA
AACTTCACATGA


>Contig20200.0.g58(protein)
MSSDINVMLGNIEAGSPEDLSMKSFEAYQKSNFKETQKLLDKLKSGLDEKDSRYQQNVLI
TQYYAEKCKFPQKYLNDLTNLATDMVQITKAPNCSIKQVTENGVTQNLIQIGNQYQIPAN
LAQQYQQASDQLQGQNPGGQSIGAGVGSQQNQTFQQRAGVQGQVGKSSNLSIDGQQIFQL
SVNEVNPVLLYNIAAMSYQLQQYGKSLSYLIEIIKNLEQVEEFLMIKSMFLMLQILYELK
QNESAWPIIYYLKVKLREFQQTIQQKQLIRSQTEEEIKSHNSTQEESKSDMSEEFLDVNV
LNKNSFCIINTSYLRKHAISPKNMNIHEYMFLLKSFTSLFLLQQGDVEGAQLELKSAGEF
KDKYGQDPVKVKSQINVLAMVQHLGMVNSLKAQIHLKEGNFLKSIKTLTLDEKASNSPHP
SCNFIKLQDENSKADSVYQKCQNSFPHYYFNNLGIIHLKLQKYSLAIFYFSKALKYVEKS
QNGQPSLQNDSDNPNEHISHLNTQKISEILYNYGIALFKVGKFEEAFRSFEKASHSLRHH
PRLWYYMGQASLSLNQQLYQESLSSQYQSDVFYKAMGFGEPSYTKVNSQQQHKRFILTQT
GDSLQNLESAMTSHDQTQFEKLKQQQQEILKSQSQGYIQKQTKAQQKKEKLAQQQKQNQI
NMPPESMSLQSAIMYFQNALIGIEEHKQNEINYSLYIRFLLRQQHLNSVITANNERIQVG
HFSVGVSQNLPDSINASFEPQNLNESEDIQYLTEYPQSQQDLIAYKQQIRQQVDKKYETL
KKNILMHLCYAQLLSNDFQSAIKTGNNILRNLNPNAQTKFIVMQYLAEAYTMMGQTQQAL
DCLKVENQLDPEVKLKFDNVASNIREEKSSLNSSIIQTINISAINICAGDMDQAKATFDQ
ALEALELKLQTTEMESKNLLPSYLVNLLVYFYIKAKNFKMARQLLKSRRYVLDTGHIETA
QTGQISQAQKSRNKSKTLIRNFT