Identifiers and Description

Gene Model Identifier

Contig11030.0.g71

Standard Name

CLP1

Aliases

Contig11030_0_g71

Description

Molybdopterin guanine dinucleotide synthesis protein B

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005902008.003017249547689e-39hypothetical protein
SGDYOR250C0.00000000006996681903814525CLP1 SGDID:S000005776, Chr XV
from 802307-800970, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11030.0.g71(coding)
ATGGTAGATAAAGAAATTAGGCCAGTTCCTGTGGCAATGCCTTAACCATTGAAGACAGAG
ATTCTATAAGCTGGGTCAGAATTGCGTATCTACTCTATAGAAGATCACATTAAGGTGTTG
TTGGTAAAAGGCTTAGCAGAAGTATTTGGTAAAGAATTACCACTTGAAGAGCCTGTTTTC
TTCCACTAAGGAGAAAAGCTTGCGATTTTTACGTGGCATGGCGCAGAGATACAAGTGAGT
GGAAGGTGTGAAAGTTACTAAAGCAGTCAAACTCCCATGTACTACTATATTAATTGTCAC
TCAGCACTCAATCAACTTAGACAGCACGCGCTGAAGAACTTGCTTCTTGGACCAAACTTG
CTAGTTACTGGGTCTCCTCAATCAGGTAAATCAACTTTGTGTAGAATACTCCTAAATTAC
TCATTAAAACTTGGCTGGACTCCTTTATTCTGTGATTTAGATTTAGCTAACAACGAGATT
ACTCCTCCTGGAACAATAGCTTGTGCCTTAGTTGAAGAGCCATTGCCTAATGATGAATTA
ATATCTTAATCAATGTGCTTCTTTTAGAGTAGTACCTCTCAGCCAATTACTTAAGAGTTT
TTTGTCAGATAAATTGATTAACTTGCCAAATCTACTCAGTAAAAACTTTAGAATGACTTG
CAATAGTTTAAAACTGATCATCAAATTGAAAACAGCTCTGATAATAATACAGGTCAAGTT
AAGTTAAATGAGGGCTAAAACGAAGAAAATAAGCATGCTTAGGAGTTGAAGGAAATCCAA
AAATTAGTTGCACCACCTTACCCAGAATTATTCGCTTCAGGTGTTATTATAAATGGTTTC
ACTCCTTAAGACAGAAGAGATACCGAAACATTGATAGAAGCTATTAAAGCTTTTAATGTA
GGCACAGTTTTAGTGGTAGATAATGAAAGATTGGAGAATGAAATCAGAAATGCTTTGGTG
AGAGATTCCCAGAGATAGAATAAACCAATGTCAACTTAAATTATACAGTTGCCAAAGTCA
GGAGGTGTTTAACCTGTAAAATTTGATGAAAGAGTTATTTTTGAGAAGTATTAAGAGTAC
TTTAGAGGTAAGCATTTCCAATCATTTTCTAGAAGAGACTAGAACCGCTTGAATGAACTT
GGCCTTGAGGTATAACTTTAAAGGAACGAATATGATCCCTAAGACATTAAGCTATCTCTG
GAAGAATTTAAGATCTATAAATTTGAAGGCTAAGAGATTCCTCTGACTGCACTTCCAGCA
GGAGCTACTTCTCCAAGATGGTCAACATTGCTTGATGAGGTAAGACTTCCTCAGACAGAC
TTTTAATCACTCAATCGAAAAATTTTGGCCTTTTTAATCCCCTAAGACATTTCAAAACTC
AAATAACTTGAAAGAGAAATTGCTCTCTACCCTTCCAACAATGACCTCAAAGAAGAATTT
CAAGAGTTATTAATGAAAAGTTCAACTGCAGGGCTCATGCAAATAACTGGCTATCACCCT
GAAGAGAGGAAACTTGAAGTGAGGACTATTACCAGTGATTAGATACCTAGCAATTATTTA
CTCTTAAGTAAATTTAAATTACCAAACATAGTCTGA


>Contig11030.0.g71(protein)
MVDKEIRPVPVAMPQPLKTEILQAGSELRIYSIEDHIKVLLVKGLAEVFGKELPLEEPVF
FHQGEKLAIFTWHGAEIQVSGRCESYQSSQTPMYYYINCHSALNQLRQHALKNLLLGPNL
LVTGSPQSGKSTLCRILLNYSLKLGWTPLFCDLDLANNEITPPGTIACALVEEPLPNDEL
ISQSMCFFQSSTSQPITQEFFVRQIDQLAKSTQQKLQNDLQQFKTDHQIENSSDNNTGQV
KLNEGQNEENKHAQELKEIQKLVAPPYPELFASGVIINGFTPQDRRDTETLIEAIKAFNV
GTVLVVDNERLENEIRNALVRDSQRQNKPMSTQIIQLPKSGGVQPVKFDERVIFEKYQEY
FRGKHFQSFSRRDQNRLNELGLEVQLQRNEYDPQDIKLSLEEFKIYKFEGQEIPLTALPA
GATSPRWSTLLDEVRLPQTDFQSLNRKILAFLIPQDISKLKQLEREIALYPSNNDLKEEF
QELLMKSSTAGLMQITGYHPEERKLEVRTITSDQIPSNYLLLSKFKLPNIV