Identifiers and Description

Gene Model Identifier

Contig2366.0.g5

Standard Name

CKS1d

Aliases

Contig2366_0_g5

Description

Cyclin-dependent kinase regulatory subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • cyclin-dependent protein serine/threonine kinase regulator activity (IEA) | GO:0016538

Biological Process

Domains

  • ( pfam01111 ) Cyclin-dependent kinase regulatory subunit

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007946702.000130478826482e-26Cyclin-dependent kinase regula
tory subunit fa...
SGDYBR135W7.996806159126539e-24CKS1 SGDID:S000000339, Chr II
from 504854-505306, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2366.0.g5(coding)
ATGGGATATCACTTTTCAGAACAAATCGAGTATAGCGAAAAGTATAATGATGATACTTAT
GAATACCGCCATGTCACTCTCCCAGAAAATGTTTTTGCTAATTTGAAGAGAGATGTGCTT
TTGACTGAGGATGAATGGAGAACGCTTGGCTTACAGATGTCAACTGGATGGGAGCACTAT
TTGATCTTCAAGCCAGAACCCTTCGTGATGCTCTTCAGAAGACCCCTCAACTATCAATTC
AAGCAAAATCATCAGAACTTCATGCAATGA


>Contig2366.0.g5(protein)
MGYHFSEQIEYSEKYNDDTYEYRHVTLPENVFANLKRDVLLTEDEWRTLGLQMSTGWEHY
LIFKPEPFVMLFRRPLNYQFKQNHQNFMQ