Identifiers and Description

Gene Model Identifier

Contig21546.0.g86

Standard Name

CKS1c

Aliases

Contig21546_0_g86

Description

Cyclin-dependent kinase regulatory subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • cyclin-dependent protein serine/threonine kinase regulator activity (IEA) | GO:0016538

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBR135W9.996273942859018e-26CKS1 SGDID:S000000339, Chr II
from 504854-505306, Genom...
T. thermophilaTTHERM_012488909.995317835403734e-19Cyclin-dependent kinase regula
tory subunit fa...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21546.0.g86(coding)
ATGTTACGCTAAACATCTACTTAAGATAAGCCAGAATATTCTGAACGCTATACAGATGAC
CACTACGAATATCGTTATGTAGTGCTTCCGAGAGAGATGGCCACTGAACTGAAAAATAGG
GGCATTCTTAAGGAAGAAGAATGGAGAGGTATGGGCATCACTCAAAGCAGAGGCTGGGAA
CACTATGGTTTTCATAAAGCTGAGCCTCATATTCTACTATTCAAGAGGCCTCTAGGCACA
GACCCTAAAACAGGCTAAGTGAATTCATAGCTAATTCATGAGCATGAAGAAAAAATTAGA
TAGGATAGGGAAAGATTTATCAGCCAACTTGTTCAGTGA


>Contig21546.0.g86(protein)
MLRQTSTQDKPEYSERYTDDHYEYRYVVLPREMATELKNRGILKEEEWRGMGITQSRGWE
HYGFHKAEPHILLFKRPLGTDPKTGQVNSQLIHEHEEKIRQDRERFISQLVQ