Identifiers and Description

Gene Model Identifier

Contig15320.0.g74

Standard Name

CKS1a

Aliases

Contig15320_0_g74

Description

Cyclin-dependent kinase regulatory subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • cyclin-dependent protein serine/threonine kinase regulator activity (IEA) | GO:0016538
  • G protein-coupled receptor activity (IEA) | GO:0004930

Biological Process

Domains

  • ( pfam01111 ) Cyclin-dependent kinase regulatory subunit
  • ( pfam06652 ) Methuselah N-terminus

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012488902.0003218023735366e-33Cyclin-dependent kinase regula
tory subunit fa...
SGDYBR135W1.999790113608142e-24CKS1 SGDID:S000000339, Chr II
from 504854-505306, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15320.0.g74(coding)
ATGCCACATTTCCCAGACGAAATCGAGTATTCAGAAAAGTACGAAGACGATTCCTACGAG
TACAGACATGTTTTGCTTCCCAAGCACGTATTCAAGAAGATGGCCAGAGGTCGCCTCCTC
ACTGAGACAGAATGGAGATCGCTTGGTGTTCAACAATCCCGCGGGTGGGTTCACTACGAG
GTTCACAAGCCAGAGCCATTTATTTTGCTCTTTAGACGTCCACAAGGCACTGATCCCAAC
ACTGGTTTACTTCCTCAAGGACATCCACTCTACTAGCAGTAATTGCAAGCTATGAAGAAG
TGA


>Contig15320.0.g74(protein)
MPHFPDEIEYSEKYEDDSYEYRHVLLPKHVFKKMARGRLLTETEWRSLGVQQSRGWVHYE
VHKPEPFILLFRRPQGTDPNTGLLPQGHPLYQQQLQAMKK