Identifiers and Description

Gene Model Identifier

Contig17923.0.g79

Standard Name

CHROMO5

Aliases

Contig17923_0_g79

Description

Chromo (CHRromatin Organisation MOdifier) domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam00385 ) Chromo (CHRromatin Organisation MOdifier) domain

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17923.0.g79(coding)
ATGAGTTTTGAAGATAACTAAGGAGAAATTGATCAAATCATTGAGTACAGAGTTTCCCAT
TCAACTGGGCTTCACGAAGTGCTAGTTGAGTGGAAGCAGGCAAATCCATCATGGGAACCT
TTGCAGAGTTTGTATAAAGATGTACCTCAACTACTTACAGACTTTTTCAAATCTGTTGGC
TAAGACATTTCTGACATACTTGAGATTGAGTCATAAGCTTTGAGAGCAAAGTATTAGAGT
GAGAGAGGTTATGGAAGAGGGAGAGGAGGAAGCAACTACGATAGCACAAACTAAAACTTT
CGAGGTAGCTATTCAAGAGGTAGAGGAGGAAGCTATGGTGGACAGAATCGTGGTGGATTC
GGTAGAGGAAGCGATTAGTCTTTCCAGACCAATTCTTAGACTAATAGCTTTGGCAACAGT
AACTACAACAACAGATACAGTGGTAGAGAAAGTTCAAATCGCAGCTCGTATGGTGATAGG
AATTCATAATAAGAATAGCGTAACTAGGACAATAGTCAAGGTCCGTCGTAGCAACAGCAG
TAATGGGTTAACAGAGAGGAGTTTGATCCTAAAACATTTAGGAGAATGATGAGATCAAGA
GCTGCTGACAGAAAGATACAACAATGGGAAAATCAAAACACACAGGGTCAAAGTTAGGAG
AGTTAGCCAAAAGAACAGCCTAAGTCTAGTAATTCAAGTTTCATGATGGAAGAGTCACCA
GTTAGGGAAAATCCCTCTAACATCTGGTCTACAAAATCTCATGCATCCAGCTAAGACACT
CAAATGAGGGATTCTTCAAACTCTCTTGCAGAGACGGTAACCACGTCACCCAGGATATCT
GATAAACTTTGGGGTTCTAGAGATTCTGGTACTTATGGTGCTTCAGATCAAGCTAGCACT
TTCCAAAATGTAAACTCAATCTAAGACTTCTATAAGCATTAGAAATTTCAAGAAAAACGC
CAGAAAATGTAGTAAGCTTTGGAACTCTAAAGGCAGAAACAAGCAGTTGTAGAGAAGCAA
GAAGTTATTCAGAGAGTACTAGACCAGCCTCTCAAGGACTATTCCAAGAGTACCTCTTAG
GTAATTTTCAAGCCATCTTGTGATAGGTAGACTTTCCATTCAGCTATGTCTTCAATTGAT
GAACTTTAACTCTCCTCACACAATTAAACTTATGATAATAAAGCATCAAGCTGCAATCCC
TAAAATAAACAAAATTCCTCACCCTTTAGTGACATTTCTCTGCCTACAACGACTACAACT
AAGTCCTCTACATAACCTTTCACATAAAACTTTCTCAAACTGTAAAAGATCATTCACTCA
AATTACGATTCAACTACAAATTAATACAGCTACCTCTGCCAAGTACTAGGTCAGAGCGTC
TGTGAATCTTAGTATCAATATTAGTATTTCCAGTAGATCAACAGTGAAGAGGTGAAAAAG
AGAAACGAGCATCTGCAAGCAGCTGTGAACTACTATGAGAATATGTTTGTAATGAGTGCT
CTTAGAGATTAGAATCAAAATATTTATCAGTAATGA


>Contig17923.0.g79(protein)
MSFEDNQGEIDQIIEYRVSHSTGLHEVLVEWKQANPSWEPLQSLYKDVPQLLTDFFKSVG
QDISDILEIESQALRAKYQSERGYGRGRGGSNYDSTNQNFRGSYSRGRGGSYGGQNRGGF
GRGSDQSFQTNSQTNSFGNSNYNNRYSGRESSNRSSYGDRNSQQEQRNQDNSQGPSQQQQ
QWVNREEFDPKTFRRMMRSRAADRKIQQWENQNTQGQSQESQPKEQPKSSNSSFMMEESP
VRENPSNIWSTKSHASSQDTQMRDSSNSLAETVTTSPRISDKLWGSRDSGTYGASDQAST
FQNVNSIQDFYKHQKFQEKRQKMQQALELQRQKQAVVEKQEVIQRVLDQPLKDYSKSTSQ
VIFKPSCDRQTFHSAMSSIDELQLSSHNQTYDNKASSCNPQNKQNSSPFSDISLPTTTTT
KSSTQPFTQNFLKLQKIIHSNYDSTTNQYSYLCQVLGQSVCESQYQYQYFQQINSEEVKK
RNEHLQAAVNYYENMFVMSALRDQNQNIYQQ