Identifiers and Description

Gene Model Identifier

Contig11039.0.g65

Standard Name

CHROMO4

Aliases

Contig11039_0_g65

Description

Chromo (CHRromatin Organisation MOdifier) domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam00385 ) Chromo (CHRromatin Organisation MOdifier) domain

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11039.0.g65(coding)
ATGAGCAAACCAGATCCCGGACAATCTCTAAAAGAATCCTTGCAGGTAGACTTGGCCGAC
ATTCATTTTAAGGAGCCTAACTTGTTTCATCTCAAATCCTCCGACCAAGAATTAATGAAT
TCCATGGAAATGGATTAACTGGACAGTTTATAGGACGAAATAAATTAAGATGAAATGGTT
ATTGAGGATTTCAATATCGATATAGAGCAAAAATAGAATTAGGAAGAATTAAAGAACAGC
ATCAAAGGTAAATAAAATTTCCAAAAGTCATAAACATTGAGCATAGGTCATGAAAAAATG
TACACTCCTTAAAAATCTAAGAGTAATACAGACAATAACATATCTCCTCAATCAGCAGAC
AAGTTTTACGCAATGACAGACAATTTTGGAGAGAAATCCGAGATGCATGAAATTATCGAC
ATCACTTATCACAGAAATATCAAAGGTATCAAGGGCAGGCAGTATTATTGTGTCTGGCAA
AATCATGAACCATCCTGGGAATTTGAGAAGCTCATTAAATCACAATGCTAAACTTTAATA
AGTAACTACTGGTTGAATATAGGGAAATTAAGTCTTAATAATACTCAAAGAAAGTTTCCT
GATGATATGGAAGTCCTAAAGAAAAATAAATGCATGATTGAAGATGGGATTTAAGAACCA
AATTTTAAGGTCGAGAAAAAGAGACACAGGACTAATAACAATATCTAACAAATCTCAATG
ACTTAAACTGACTAGTTAGATAATTTACTAGAGTCTAATTAGCCCGTTATTAAGAGCAAT
TTTAATTAAAGCTCTGTTTTACAGATCTCAAAGAAGAAACTGAAACTAAGTACTCCAATA
AAAATCTAGCCAAAAAAGAAATTAGATTGTTTAGATGAAAAAACTGGGTTGGAAAAATAA
TAATCGTATAATGAGCCTATAAGTTTATCTCAAGACAGTGATTTATGTAAGAGCCCATAG
ACTCTAAAAGCTCAAGATAAAAATGCAGGCATTACAGTTTATGAAGATTTAGAGACAGCT
TTACTATCAAATATTGGAAATTGGAAGAAACTAAAAAGATAGGGCAACAAAGACATATAC
AAATGTAACGAATGTGAAACTTTGCTTGAAGTTGAGAGGAAAGTGTTGGAATTCAAAGTA
AGGCTTGTCAATTATGGATCAGACTAGATTCATCACAATTGGTTTGATGATTCCCATAAA
GAGCCTTTTAGTAATAGAGAGGCAATTGATAGATCAGATAAAATACATACCAGTGCTGAG
GCATTCATAAAACTTTAAATGAGAGAACGAAGAGGCAATTAACCTACTGAGATTCTCGAA
TGCATGAGACGAGAAAGGCCTTAATTATATAAGTATTTCAGGCCCACTACAGATTAGATT
GCATACTACATAGTTAGCAACACTAGAGAGCTGACATCAAATATAGATGCATTTGATGGT
CATAGAATAACAAGAAGCAATAAATCCACTACCCCAGTAAACAAATTCCCTATTGACCTC
GATCACATGCCTAAGAAGAGAGACTAGAAATCTATAGAGAAAAAATAACAGGTTGAGTAC
TTTAAAAGTTTACTAGGCTAGATGAATGGCTCTTAACAAAACATTTCAGAAGAGATAAAT
ATTCAAAGAGTTCAGTCTGAAGAGGAAAACGAAGATAAAATTATAGAAGAAAAGCCTTAA
TTACCAGTATAAGTTAAAACCTTAGTTTAAGATAAAATCTAAGTTGCTGAAAAACTTTCT
AAGAAGCAATTTAAAGAGAATTCAGAGCCTACTACTGATTTTTAAGTTAAAAAACAAAAA
CTCCCTACCACTCCAGTGAACTAAAAAACCAATTTTAGATCCACTTCAGAAAACCTGAGA
AACAAGAGAGTTAAGTTTAACACAGAGGTTGAAGAAGCAGTTTTTCAAAAAGTCTCTTCA
GATGATGAACAGTACAATAAGTAAATAATTGAATATCTAAATAGCTAGAGAAGCAATCAA
AAGGATTATGATTAGGAAGACAAAGATGAAGAAGATTGTGAAATGAGAAGCGACAACAGT
AATCTACATATTTAGGATAACTCATCATAAAATAAATCGATTGTGTAAGAAATAAAGAAA
GAAAACATAAGTCCAGAGAAGAAATTTAGCCAATAAAGCGAAGACGAAGAGGCTATTCTT
GCCAAAGATTTTGACAATATAAGTTCAGATGAAGAAGAATACTAAAATGGGAACTTTTTG
GAGTATATAAAGCATGAGACTCTTAAAGCCCACAAAGAAAGAGAATTCGTGATTAATATT
CTAAAATCTAGAGAGCCTAGAGGAAGCATATTCATAGATAAAGTAAAGAAAGTAGTGACA
GCAGTTCAAAGAGATACTGGTAAATTCGACTACCTAATAGAGTGGGAACATTGCAAGAAG
ACAAAAATTACGCCAGCTACTTCTCTTGTCAGGGGCTCACACTTCGTATTTTCCAACCCA
TTGCAATACAGAAGGTATGTTGAATAAGTATTCATGGAGTCAGCACAGCATAAAGAAGGA
TTGATAGTGAAAAAGTGA


>Contig11039.0.g65(protein)
MSKPDPGQSLKESLQVDLADIHFKEPNLFHLKSSDQELMNSMEMDQLDSLQDEINQDEMV
IEDFNIDIEQKQNQEELKNSIKGKQNFQKSQTLSIGHEKMYTPQKSKSNTDNNISPQSAD
KFYAMTDNFGEKSEMHEIIDITYHRNIKGIKGRQYYCVWQNHEPSWEFEKLIKSQCQTLI
SNYWLNIGKLSLNNTQRKFPDDMEVLKKNKCMIEDGIQEPNFKVEKKRHRTNNNIQQISM
TQTDQLDNLLESNQPVIKSNFNQSSVLQISKKKLKLSTPIKIQPKKKLDCLDEKTGLEKQ
QSYNEPISLSQDSDLCKSPQTLKAQDKNAGITVYEDLETALLSNIGNWKKLKRQGNKDIY
KCNECETLLEVERKVLEFKVRLVNYGSDQIHHNWFDDSHKEPFSNREAIDRSDKIHTSAE
AFIKLQMRERRGNQPTEILECMRRERPQLYKYFRPTTDQIAYYIVSNTRELTSNIDAFDG
HRITRSNKSTTPVNKFPIDLDHMPKKRDQKSIEKKQQVEYFKSLLGQMNGSQQNISEEIN
IQRVQSEEENEDKIIEEKPQLPVQVKTLVQDKIQVAEKLSKKQFKENSEPTTDFQVKKQK
LPTTPVNQKTNFRSTSENLRNKRVKFNTEVEEAVFQKVSSDDEQYNKQIIEYLNSQRSNQ
KDYDQEDKDEEDCEMRSDNSNLHIQDNSSQNKSIVQEIKKENISPEKKFSQQSEDEEAIL
AKDFDNISSDEEEYQNGNFLEYIKHETLKAHKEREFVINILKSREPRGSIFIDKVKKVVT
AVQRDTGKFDYLIEWEHCKKTKITPATSLVRGSHFVFSNPLQYRRYVEQVFMESAQHKEG
LIVKK