Identifiers and Description

Gene Model Identifier

Contig4006.0.g100

Standard Name

CHROMO2

Aliases

Contig4006_0_g100

Description

Chromo (CHRromatin Organisation MOdifier) domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam00385 ) Chromo (CHRromatin Organisation MOdifier) domain
  • ( pfam14010 ) Phosphoenolpyruvate carboxylase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_013374000.0000029996948234116693heterochromatin protein 1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4006.0.g100(coding)
ATGTCTCAACCTAAAACAGATGATGTAGAGTAGCTCTTCGAAGTGGAAAAAATCCTGTCA
AAAGTAGTTTAAAATGGCAATCAAGAATATTACGAGGTCAAGTGGTTCGATACAGAGGAG
ACTACCTGGGAGCCTATTGAAAACCTTAGTAGTGTGCTACATTTAATCGAGGAATTTAAC
AAGAATCTGGAGAATGTCGAATAAGTTAAAGCAGCGGCTTTTATAAGCGAGCCAGAAGCA
AAAAAAGAAGCCAGTTAAATGCAACAACTTTTAGCTAAAGGACTTGCTGAAGGTGGCAAC
TACTATATGACAGTGAAATAGCAACTCTTAAAGAGAAGTCAAGATGCCAAAATAGCAAGA
TAATCTGCAATTAATTCAACTCTTAAAAACAATGGATCACAACTCAATAATAACGCAGCA
ATGGGAGCTCAGGATATAAACATGCCTGAATAATTTGAATAGCAAATTCATAAGCGAAAA
CTAAAGAAGTCGAGAGAACAGAAATTTGTAGATGGGTCTAATATGCCTCATGATCTTCAG
ACTGATATTTAGATAATAAGCAGCTATAACCCAAACAAGCAGCTTGACAAGAAGAGAGAA
AAGCTCACAGAAGAGTAATTGAAGAGACTAGATAAGGATGCAGCTTTTGTGGCTTAAAAT
GCACATAACGCTTGTTACGATAAAAATATATAAACTTTTTCAAATTAAGATCATGGAGTT
ATTATTCCTACCTAATAGCAGACTGTTATAGAACTCGATTAATCTGGCAAGCCGAAATCC
TTAGATACACTTCTGGGAAAGCGGTCGATACAAAACATTGAAATTGGGAATTTACCTAAA
AATGGCTCTTTTGAAACAGATTTACCTTCAATGATATCTAAAGCGAGATATGAAAAGGGC
CGCTTACTTTTGACTGTATAATGGCATCCTAGACCTAATGGTTAAGTGCCTTGTTAAGAA
AAAACCTGA


>Contig4006.0.g100(protein)
MSQPKTDDVEQLFEVEKILSKVVQNGNQEYYEVKWFDTEETTWEPIENLSSVLHLIEEFN
KNLENVEQVKAAAFISEPEAKKEASQMQQLLAKGLAEGGNYYMTVKQQLLKRSQDAKIAR
QSAINSTLKNNGSQLNNNAAMGAQDINMPEQFEQQIHKRKLKKSREQKFVDGSNMPHDLQ
TDIQIISSYNPNKQLDKKREKLTEEQLKRLDKDAAFVAQNAHNACYDKNIQTFSNQDHGV
IIPTQQQTVIELDQSGKPKSLDTLLGKRSIQNIEIGNLPKNGSFETDLPSMISKARYEKG
RLLLTVQWHPRPNGQVPCQEKT