Identifiers and Description

Gene Model Identifier

Contig19772.0.0.g72

Standard Name

CHROMO1

Aliases

Contig19772_0_0_g72

Description

Chromo (CHRromatin Organisation MOdifier) domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam00385 ) Chromo (CHRromatin Organisation MOdifier) domain

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19772.0.0.g72(coding)
ATGAACGCCTCTAATTAGCAAAGTGATTCTAAAGCGAGTTCTGATGATGAATAGGAATAT
GAGATCGATCACATTGAGGGGTACAGATTGAAAGAGAAGACTAATTAGATTGAATTCTTG
GTAAGATGGAAGGGATATGGTCAAGAAGCAGACACATGGGAGTGCTTCGAAATGTTCGCT
CATGACGCTCCAGGAATAGTCCAGAAATACCTCGTAAAGGAAGTCTTCCAGAAGAATAAG
CTCCCTAAATAAATGCAAGGTGTTTAAGAGGAAACTAAGGAGCCCTTAAGAAAGTAGAGC
GATAAGAAAATCATTGAACCATCCAAGAACTCAGTAGCTAGGATTATATCTCAATTTGAG
TATGGATCAGAAACGAAAAATATTGGATTTCTTGTGGAATTTACAGACAAAGAAACTGGT
AAGTAGAGAAGAGAACTGATAAAGGAGGAAGAACTTTTAAACACTCACAGCAAAGAAATG
TATTAATACTTGTAAGCAATACTCAGATTTGAGAAAAAAATCCCTTTGAAGAAATCAGAG
CTAATGTCCCCTAATTTTGAAAATATTCTTGATAACCTCAATAACGTAGGAGCATAGAAA
GATCAAATTAAAAGCAGCGTAAAACCAAGAGTTAATGAGAGTAATATGGAGCAGTAAGTA
CCATTGGAAGACCTTAGTACAATCACAAGTAGCTAAGATCAAAGTTCTATTAAGAAAGGA
AAGAGATCAAGATAAGGAAGCACCTAACCAAAATAGTGA


>Contig19772.0.0.g72(protein)
MNASNQQSDSKASSDDEQEYEIDHIEGYRLKEKTNQIEFLVRWKGYGQEADTWECFEMFA
HDAPGIVQKYLVKEVFQKNKLPKQMQGVQEETKEPLRKQSDKKIIEPSKNSVARIISQFE
YGSETKNIGFLVEFTDKETGKQRRELIKEEELLNTHSKEMYQYLQAILRFEKKIPLKKSE
LMSPNFENILDNLNNVGAQKDQIKSSVKPRVNESNMEQQVPLEDLSTITSSQDQSSIKKG
KRSRQGSTQPKQ