Identifiers and Description

Gene Model Identifier

Contig5554.0.g99

Standard Name

CHL1

Aliases

Contig5554_0_g99

Description

Helicase C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPL008W6.998759398018207e-85CHL1 SGDID:S000005929, Chr XVI
from 539385-541970, Geno...
T. thermophilaTTHERM_006831802.0004907641180118e-81DNA repair helicase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5554.0.g99(coding)
ATGGATAAAATCTACGACACTCTTTCTTAAGAGAAGAAGATAGGTTTGTTTGAATCTCCT
ACAGGAACTGTAATTAAAAAATACATTAGGCTCAATTTTATATAGGGTAAATCTTTGAGT
CTAGTCTGTGCAATTCTTACTTGGTATCTCGGAAAAGACAAACAAGTAAAATGTGAAAAA
TCAGATATTAAAAAAGATGCAAAAGAAGATGATTGGCTTAGCATGTTTGGTGCTCCAGTT
ACCAATGAGGTATCAAACAAACCTCAAGTAAGGAATCTAAACTAAAAGAGAGTTTTTAAA
AATCTGAACTCAAATGACATTAGAGAAGTCTAATAGAATCTCAAAAGAAAAAAGGAAGCG
CGTCTAGTCAACCAATCTTAGCAACCCAATCTAAACGATGAGCACTTATTAAATTACGAT
AGTGACAAGGAAAAAACTTAATAAAAATTGAAGTAAATCTCATAAAAAGCAAAATCCCTC
GGATAATCTTCTAATAATCATCACTAGTTGAATAGTCTGCAATAAAAAGGTTTGTGTGTG
CATGAGAAGTTTAAAGATATTGCAAGCACTAATTTACTCAATGAAAAATGTCAGGACTTG
ACTGAAAAATCAAAATGCATCTATAATGATTAGGAGTTGACTGATATCTTCTCAAATATT
GTGCTGGAAAAAGTTTAAGATATTGAGGAGATTGGTAAATCAGCAAGTGAGTTGAAAATT
TGTGGGTATTTTGGTTCAAGAAAAGCCATGGCAGAAGCTGATTTCATTGTCACTCCTTAT
TAAAGCATTCTAAGTGAATCTACCAGAGACTCTTTGGGCATATCTTTGAACAATAAAGTG
TTGATATTTGATGAAGCACATAATATAATGGAGACTATATGCTCTCTTAACACAGTCTCT
ATATCTCTTACCTCTTTGGAAGGTGGATTCAAGTAGATATCAGCTTACCAATAAAAGTAT
GGTAACAGACTTGCAGCAAAAAATCAAAAGTACCTCAAAGATATACTCAAGATTGTTGAT
ACTATAAGAAAATATCTCTTCCAGAAATAAGAAAACAGGAATGAAACTAACTAATAGCCT
GAAAATACTAAACAACAGCCATAATAAACAATCAATGTGATGGATTTCTTAATTGAGACA
GACCTCTACAGTACAGACTTTGTTAAACTGTATGAGTTCTTTGAAAAATCTGATCTTGTG
AGAAAACTGAATGGATTTATATAATCAAGTATAATGTAACAAAATCAGACAAATCAAAAG
ACTTAGAATAAATCGAAACCCAACCTAGATGAGTTTTAACCCTAAACTTTCTCCAAAAGT
GTACTTTATGAGATCAGAGATTTCATCAGGATTCTCTCACATAATCCTGATGATGGGAAA
TTCATCTTGGACATGGCTTAGACTATGATAAGTAACAAAGATCAATAAAAGGCTTCTCAA
ATTAAGCTGACTTATCTATGTCTCAATCCCACATCAACTTTGAAAAGAATCTTAGATCAG
GTGAAAGCTGTCATATTTATCAGTGGAACTTTGGAGCCATCTCAGGAGTTTAACATGCTT
TTGAAACATGTCTAGCAAGATTAAGTTTAAAGATTTAACTGCGATCATATAATACCCAAA
CAGCATTTTCAAGCTCTTGTAATTCCAAGTTATAATTCTAGTTAAATGGATTTTAGACAT
TAGTAAAGGCAGAGTGACAAATAAATGCAAAATTTGATTGATATCATTATAAAAAGCTGT
GAAGTTTCACCCTCGGATGCAGGAGTTATAGTATTTTTGCAATCTTATGGCTATAAACAG
ATATTTCTCAACTTCTTTAGAAAATAGAATGAAGCAGAATATGAAAAACTGAAAGAAGCG
AGGAAAGTATATGAGGAACTATAAAACTCTTAAGTTGATGTATTTGCTGAGTATTCTAAA
GAAATCTTACAAAAGAAATAAGGTGCTATCTTATTCTGCGTTATTGGAGGTAAACTGTCA
GAGGGTATAAACTTTTCAGATAACTTAGCCCGCACCCTTATAGTGGCAGGCCTCCCTTAC
CCCAACTCCATGTCTGTAGAAATTTAAGAAAAAATGCGATACTTTGACACTCGAAATGAA
CCAGGTTTCAAAGGAAGTGATTTTTATGAAAATTTATGTATGAAAACTCTTAACTAGTCA
ATTGGTAGGGCTATCAGACACATCAATGACTATGCTTGTATAATCTTAGTGGATTAGAGA
TTTAGCAATAAAAATATCTAAAATAAACTACCGAAATGGATTTAGAGTAGAATTAAAGAA
GTAGAAGAAGGAGAGAACTAACTTGCTTTTGATATTTAGAGATTTTTTAAGTATTTTTGA


>Contig5554.0.g99(protein)
MDKIYDTLSQEKKIGLFESPTGTVIKKYIRLNFIQGKSLSLVCAILTWYLGKDKQVKCEK
SDIKKDAKEDDWLSMFGAPVTNEVSNKPQVRNLNQKRVFKNLNSNDIREVQQNLKRKKEA
RLVNQSQQPNLNDEHLLNYDSDKEKTQQKLKQISQKAKSLGQSSNNHHQLNSLQQKGLCV
HEKFKDIASTNLLNEKCQDLTEKSKCIYNDQELTDIFSNIVLEKVQDIEEIGKSASELKI
CGYFGSRKAMAEADFIVTPYQSILSESTRDSLGISLNNKVLIFDEAHNIMETICSLNTVS
ISLTSLEGGFKQISAYQQKYGNRLAAKNQKYLKDILKIVDTIRKYLFQKQENRNETNQQP
ENTKQQPQQTINVMDFLIETDLYSTDFVKLYEFFEKSDLVRKLNGFIQSSIMQQNQTNQK
TQNKSKPNLDEFQPQTFSKSVLYEIRDFIRILSHNPDDGKFILDMAQTMISNKDQQKASQ
IKLTYLCLNPTSTLKRILDQVKAVIFISGTLEPSQEFNMLLKHVQQDQVQRFNCDHIIPK
QHFQALVIPSYNSSQMDFRHQQRQSDKQMQNLIDIIIKSCEVSPSDAGVIVFLQSYGYKQ
IFLNFFRKQNEAEYEKLKEARKVYEELQNSQVDVFAEYSKEILQKKQGAILFCVIGGKLS
EGINFSDNLARTLIVAGLPYPNSMSVEIQEKMRYFDTRNEPGFKGSDFYENLCMKTLNQS
IGRAIRHINDYACIILVDQRFSNKNIQNKLPKWIQSRIKEVEEGENQLAFDIQRFFKYF