Identifiers and Description

Gene Model Identifier

Contig15121.0.g9

Standard Name

CHD1b

Aliases

Contig15121_0_g9

Description

SNF2 family N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00176 ) SNF2 family N-terminal domain
  • ( pfam00271 ) Helicase conserved C-terminal domain
  • ( pfam00385 ) Chromo (CHRromatin Organisation MOdifier) domain
  • ( pfam00628 ) PHD-finger

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001938009.998807231077743e-170Type III restriction enzyme, r
es subunit fami...
SGDYOR304W1.99970314379378e-94ISW2 SGDID:S000005831, Chr XV
from 884514-887876, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15121.0.g9(coding)
ATGGCAAGAACTAGAAATTAAAACAAGTCAAATGCAGAAGCTCCTAATAAAGGCAGTAGA
CAAGGGGGTTCTGGGAGGAGAAGAAGAAAAGGAGAAGATGATGAGTTTGAATACAATGAC
GACAACTAAGAGGAGAAAATGTTTTTGCATGACGACGATGATGATGAAGAGGAAGACTCT
CAAGAAGAGGAGGAGGAAGACCAAGAGGAAGAGGAGAAGAAAGGTGATAAGAAGAGGACT
AGAGGTAGTGATAAAACTAAGAAATCAGCAAATGATTAGCCATAAAACAAAAATAACAGT
CAGCAAGAAGATGATGAAGACGAAGATGATAATGAAGACAAGTCCCCTTCCAGAATAAAG
TCAAGTGGAATAACAGGCAATCAACATGCTGAAATTGATCCACTGACATTCGTTATTGAG
AGAGTATGCGGAGACAAGATTGAAGATGGAGTTCAGAAATATCTGCTTAAGTATAAAGGT
TTGAGTTATCACTATTGCAAATGGATTGGGGAACACGAAGTAAACTCTCTCACATATCAA
TGTCAAAACAGAATCAAAAGATACAACCAAAAGAAGGAGAAAGATGCTTAAATGGGCGTT
TAGCAGTAAATTAACGATGAAGCTTCACTCTACTTTGACAAAAACTTCCTGGAGGTTGAT
AAAATACTTTCAAGCACAAATCTATTTCCAATTATTCATCCACATACTTCCAAGAAAATC
AACGACTCATGGAGAGAGAGATGTGTAGATATTCTGCAATATATTATAAGTTACTCTAAA
GACAATCATTACTATGGAATACCATTTTTGTTCTTGAAGACAGAGGATAATAATGTCATG
GATTTTACAACAATTAATAACAGACTCTACACAATGAATAATCCTCCTCCTCCAGCGCCT
TCTCATTAGACATAACTGAGTTTCAACAATCAATAAAGAGGTTAGCAGTAGCAACAACCC
CCATAACAGCAAAACTAAGTTTAGTACAATCCCTCCCTATTTTGGCAAGATTTAGGTCAA
GTTTTCAAGGAAAACTTTAGAATCTATCACAGCGGTACTAAACAAAGAATATTCTTAGAA
ACTTTAAGAGAGTTGGCATTCTATCTTTACTCAGCTTGGCATAAAATAATAGAAGAAGGT
TAACCATTCGACCCTTCAAATGTAGATCAAGCAAAGACTTTAATGATAGAATTGCAAAGT
TTCTTGACTTAGTTTAAGGAAATGAATGATGGAACTACAAACAAAGACCAGAACTAACTA
AACTCATTGAAACAAAAAATGAAGTTAACAGCTGACAAAATTAAAGACTTAACTCTGAAA
AATTTAAATGACTTAGACAAATTTGAATAGGCTGACAGGCTTTAAGTATGTCAAAATGTC
ATTGGTTATTTTGAAAGATCCCAAGATGATACCTTCTACGATCAAACTTAAAATTTGATA
AAGAGTATACTAAGCAGAAAAGCGATTAATTTTGGAGGAGATGAAGAGGTCTAAGTGGTT
GAATAAATCATGCTTAAACCTGGAGAGCATAATTTAAAAGGGCAAGAACTTTCTTACTCT
TGGCTATTAAATCCTGAAGACACAGTTGAGGAAGCAACATACAATCAAAATTTTATAAGA
GAGGATATCTTCACTTTATTAGTCAATATAAAATAGCATTTAGATCCACTATACTATATC
AAATGGAAGAATTTATCTTACTGCGACTGCACTTGGGAGAGACTATCCAAAATAAAAGAG
TATGATTTCAAAATCAAAGACTTTGAAAGATTTAACAGATCCCTTGATGGTAATGGCAGA
AAGAAAATGTAAGGTTTTGGTTTTGCAAATAAGCAAATTATCAAGCACTATGAAAAGAAG
TTACAGCAAGGTAAAAAGATTGATGCTAAATGGGCTGAAGAAACATAAACTAGAGAACTG
ATTAATTAGCTCTTGAAAACTGAAATCAAATCAACTTTAAGCAATAGTTATTTCCAGTAC
GATTTTGCAAATAATCTAGTGCCTCAATTTAGAATGGGATAAGTTATGAAAGATTACTAA
ATATCTGGACTTAATTGGATGCTTAAGGCTTTCTAAGATAATAGAAATGTAGTATTGGCT
GATGAAATGGGACTAGGAAAAACCATTCAAACCATCGCTTATCTTGATCATCTGATTAAG
ATATGGAAAATTAGAGGGCCTTTTATCGTGATAGCTCCATTATCAACTTTAGATCACTGG
AAAAGAGTAGCTGAAGAATGGACATTGATGAATGTGATAGTTTACTATGATTAAAGAGGC
TAAGAGGGAAGATAAGAAATCTAGAAATGGGAGTGGTTTTACACTGATATAACGAACAAG
GGTACCCTTTCTCAAAAATCTAAAATTTGCAAGTCTTCAACCAGGACTTAGTAGATGTAC
TTCAAGAAGTGCCTTTGAACTCCAATTTAAAATAATACTAAGGAGCTATTTACTATACTA
AACTATATTGAACCGGATAACTTTGGATCTTTTGAAAAATTCATGGATTAATATGGTAAG
CTAGAAACTGCTGAATAAGTCGACAGATTGCACACAATTCTAAGACCACATTTCCTTAGA
AGAATGAAAGATGAAGTTGAAAACTCAATCCCTCCTCTTAAAGAAACTGTTATAGACGTT
GGCTTAACTTCACTACAAACTACTTACTACAAAGGTATCTATGGAGAAAATCTATCAGTA
CTAGCAACTTTAGGGAATAGCAGTATGAGGACTTCACAACTAAATAATATTGACATGCAG
CTAAGAAAATGCTGTAATCATATATTCCTTCTAAAAGGAGTTGAGGAAGAACTCACTAAA
GACTGCAATACTAAAGATGATTTACTTAAGAAAATGCTTGAAAGTTCTGGAAAACTAGTT
TTACTTGAGAAGTTTATCGAGAAGTACAGATCAGAAGGCCATAAAATGTTGGTATTTTCA
TAGTTTAAAGGCATGATAGACATAATTAAGGAGTTTTTGGTAATCAAGGGAATTAGATAT
GAGATTCTTACTGGAAGTGTCAGAAGTCAAGATAGAGGTTTAAGTATCACAAGATTTAAT
GATGATAATGAATTTGGAGTTTTCTTATTGACGACAAGAGCAGGAGGTCTAGGTATCAAC
TTGACTAAGGCAAGAGTTGTAGTGATTTTCGATTCTGATTGGAATCCTTAAAATGATTTG
CAAGCTATTGCAAGAGCTCACAGAATAGGTTAATAGTTTGAAGTGAGTGTTTACAGATTT
ATAACTGCTAAAACCTATGAACAGCAAATGTTTGATAGAGCAAGTAGAAAATTAGGAATG
GAGCAAGCACTATTCTAAAAAGGAGCATTTAGTGATAAAGACGGAGATATTCCAGCTGAA
CTAAAAGCAAACCCAAAAGAAATTGAAAACTTACTAAAGTATGGAGCATATGCTTTTTTG
GATGAAGGAAGCAACGAAAACATAAATAATGCTCATATTGATGATATATTGCAAAAGAAT
CAAAACAAAAATAGCAGGGAATATAAAGCCAATAAGGGACTCTACACACTTCAAAAGTCT
TCTTTTAATGTAGATTCCGGGAGAAGCTCAACTTAAAAGAAGGGAATACCAGATGTTAAA
GATCCTAATTTCTGGGAAAAGGTTTTGCCTTTTGAAGGTATGAATCCAAAATAGCTTATG
AGAAAATTCAAAAATAAGAGAGCTGATATTATCAGTAGCAAGGACAGTCAATCCAAGTTT
ATGAAGGATGTTTCAAAATGTATAAAAGACTTACTCGAAGCTAAAGCTGTTAATGATTCT
TTGACTATTGATGAAGAAGTTTATGATCTTTTGAAAAAGATATAAAAGATGAAAGAAATG
GATAATAAATATAGAGAAAAAGCATAGCTATTGATGACAAAGCTCATTCATTTCAACGAT
TATCAAAATACAATCATTTGTGATGATAGAAATCCTGATGGAAATTAAGATGGTAGCGAA
CTAGATTATTCGATGCTTGGGAAGAGAGTACTAAAACGAAGTGCAAAAGAAAATGTAGAT
TATAAGAATAATGGCATAGCTATAAGCAGCGGGCCCTAAAATAAAAAGCGTGATTAAAAA
GCCAAAAGTAAAAAAGACTTATTAATTGGGTCTTCAGAATTGACAAGTGGAGAGAGTGAT
AATGATATTGATGGTGTAAACAGAAACAAGAGATTGGGAAGATTATGCAAAGATAAAAAG
AAGAAGAAAGTTTATCCTGGAGAAAATGTTGTCGACAGTGATGATGTTGACATGGAAGAA
TTGAAACGTATTGACGACAGTTAAGAAGATTAAGACATTGAGATGAAGGATGAAGTTGAA
AACTATGATGAAGATATTGATGAAGAACTAGATGATGAGCTAGACAAAGATCTAAAATTT
AATGACGAGTAGATTAATGAACAAAAGAAACAAAAGAAAAGCTCAAAAATCCAAAATTAA
GAAGACTTAGATGAGGAAAATAAACTATAGAGCAGGAATTATTGCACAATTTGTGAATAA
ATAGACCCACCTATTGATGTAAAATGCAGTAAATTTTGTAAAAGATGTGTACATTTCAAG
TGTATTGATGTTAGTCCTTAAGATTTAGCTTCTATTAAAGATGGGTAACTTAATTGGTAG
TGCAGTGATTGTGAAAAAGGCTAAGCTGAATGCTTTGTATGTAAGAAAATTGGGTAAATA
TAGGATAAATCGTCTTAAGCTGTAAAGATCGAAAAAAAATCAGATAAAAACGACAACAAA
AAAGGACTTGTTAAATGCAGTCAAAATTCTTGCTGTAAATACTATCATGATAGTTGTCTA
AAATAAATCGTTTCAGCTCAGACAAAGATTAAACAGAAATCAAGCAACATGAAATGTATG
CTTCACTATTGCAGTAAATGCACTTTACCAGGAGAAAAGCTAATCGAGTGTATTAAATGC
CCAAAAGCTTCCCATAAGAAATGCTTAGCTGAGGGTAAGACTTGTTAGGTACGCATCTCA
AAAAGATTCATGATTTGTAAAGATCACCAAGTGTCATCTGCTCATCAAATATAATCCACT
AGCAACTTAAACACCAAGAAAAATCAATAAAACATTAATAGCTACATGCAGGCTAAAGAT
AAGAAAAGTACTAATGCAGAGTAAAAGTTATCTAAGGCTCACATAGACAAGGATCATAAA
AAATCTAAAAAGGATCACAAAAAATCAAAATCTGACAAGAAAAGCAAGAAACATACTAAA
ATTGAGAATTTTGGAGATGATCTAAGTGCAAATTCAAATTCCACTACAGCTAATAGTCAC
ATTCCCAAAGTAGTCATTAATATGAAGAAAAATGGAGATGGAGGCAGCATAAGTGCTAAA
TAAAATTAATTATAAAGCGGGGATGACTCCTCATTAAATTGA


>Contig15121.0.g9(protein)
MARTRNQNKSNAEAPNKGSRQGGSGRRRRKGEDDEFEYNDDNQEEKMFLHDDDDDEEEDS
QEEEEEDQEEEEKKGDKKRTRGSDKTKKSANDQPQNKNNSQQEDDEDEDDNEDKSPSRIK
SSGITGNQHAEIDPLTFVIERVCGDKIEDGVQKYLLKYKGLSYHYCKWIGEHEVNSLTYQ
CQNRIKRYNQKKEKDAQMGVQQQINDEASLYFDKNFLEVDKILSSTNLFPIIHPHTSKKI
NDSWRERCVDILQYIISYSKDNHYYGIPFLFLKTEDNNVMDFTTINNRLYTMNNPPPPAP
SHQTQLSFNNQQRGQQQQQPPQQQNQVQYNPSLFWQDLGQVFKENFRIYHSGTKQRIFLE
TLRELAFYLYSAWHKIIEEGQPFDPSNVDQAKTLMIELQSFLTQFKEMNDGTTNKDQNQL
NSLKQKMKLTADKIKDLTLKNLNDLDKFEQADRLQVCQNVIGYFERSQDDTFYDQTQNLI
KSILSRKAINFGGDEEVQVVEQIMLKPGEHNLKGQELSYSWLLNPEDTVEEATYNQNFIR
EDIFTLLVNIKQHLDPLYYIKWKNLSYCDCTWERLSKIKEYDFKIKDFERFNRSLDGNGR
KKMQGFGFANKQIIKHYEKKLQQGKKIDAKWAEETQTRELINQLLKTEIKSTLSNSYFQY
DFANNLVPQFRMGQVMKDYQISGLNWMLKAFQDNRNVVLADEMGLGKTIQTIAYLDHLIK
IWKIRGPFIVIAPLSTLDHWKRVAEEWTLMNVIVYYDQRGQEGRQEIQKWEWFYTDITNK
GTLSQKSKICKSSTRTQQMYFKKCLXTPIQNNTKELFTILNYIEPDNFGSFEKFMDQYGK
LETAEQVDRLHTILRPHFLRRMKDEVENSIPPLKETVIDVGLTSLQTTYYKGIYGENLSV
LATLGNSSMRTSQLNNIDMQLRKCCNHIFLLKGVEEELTKDCNTKDDLLKKMLESSGKLV
LLEKFIEKYRSEGHKMLVFSQFKGMIDIIKEFLVIKGIRYEILTGSVRSQDRGLSITRFN
DDNEFGVFLLTTRAGGLGINLTKARVVVIFDSDWNPQNDLQAIARAHRIGQQFEVSVYRF
ITAKTYEQQMFDRASRKLGMEQALFQKGAFSDKDGDIPAELKANPKEIENLLKYGAYAFL
DEGSNENINNAHIDDILQKNQNKNSREYKANKGLYTLQKSSFNVDSGRSSTQKKGIPDVK
DPNFWEKVLPFEGMNPKQLMRKFKNKRADIISSKDSQSKFMKDVSKCIKDLLEAKAVNDS
LTIDEEVYDLLKKIQKMKEMDNKYREKAQLLMTKLIHFNDYQNTIICDDRNPDGNQDGSE
LDYSMLGKRVLKRSAKENVDYKNNGIAISSGPQNKKRDQKAKSKKDLLIGSSELTSGESD
NDIDGVNRNKRLGRLCKDKKKKKVYPGENVVDSDDVDMEELKRIDDSQEDQDIEMKDEVE
NYDEDIDEELDDELDKDLKFNDEQINEQKKQKKSSKIQNQEDLDEENKLQSRNYCTICEQ
IDPPIDVKCSKFCKRCVHFKCIDVSPQDLASIKDGQLNWQCSDCEKGQAECFVCKKIGQI
QDKSSQAVKIEKKSDKNDNKKGLVKCSQNSCCKYYHDSCLKQIVSAQTKIKQKSSNMKCM
LHYCSKCTLPGEKLIECIKCPKASHKKCLAEGKTCQVRISKRFMICKDHQVSSAHQIQST
SNLNTKKNQQNINSYMQAKDKKSTNAEQKLSKAHIDKDHKKSKKDHKKSKSDKKSKKHTK
IENFGDDLSANSNSTTANSHIPKVVINMKKNGDGGSISAKQNQLQSGDDSSLN