Identifiers and Description

Gene Model Identifier

Contig11634.0.g75

Standard Name

CHD1a

Aliases

Contig11634_0_g75

Description

SNF2 family N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001938009.997093137033517e-262Type III restriction enzyme, r
es subunit fami...
SGDYER164W3.000712232670428e-104CHD1 SGDID:S000000966, Chr V f
rom 505392-509798, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11634.0.g75(coding)
ATGCGAACAAAGAGAAAAAACTACAAATACGACTCAGATGACTTCGAGAATGGTGACTAT
GAGGAAGATGATTTCGACGAGGAAGAAGATGACTTTGACGAAGATGACCAACAAGACCAA
AGTCATCAAGAAAGTGACTATGATCATCCCAACAATGGAGGAATCGATGGTAAAAAGTCT
GGCGGAAATGGAAAGTAAACGAAATAAACTAGAAAGAATAAAAAAGAGGAATAAGAAGTA
GAGCATGAAGACTCTTATGAAGATGAGGACCCATTCTCGCCTGAAATCGACCAGATTTTA
GCGGATAAAGAAGTGGAGATATAAGCTCCTGTCACCCAGGCATAAGTTTCTAATCAATAA
AATCCTAATTAAATCAAAAGCACCCGTAATGCCACTCTGCTACCTCAAACCAAGAAAAGT
TTTATGTTTTTAGTCAAATTTACAGATCAGTCTTACCTTCATGTTCGTTGGATGGAGGAG
TCAGAACTCGAAGAGTACAGTTATCGCGCCAAGTAAAAAATTCGAAGATATTTTAACGCC
AAGGAGAAAAAAAGAATCATTCAAGAGCAAATTCAAAGGTAGGTCATAGCATTTAAACCC
ATAAAAAATCATCATTTTTCGGATGATGAGGAAGAAGAGGAGGAAGACGAAGATGCCGCC
ATTAAAGGCATCACTCTCCCGGACCTGCCCATTATCGAGGAAATTGCCGTAGCCGAGGAA
GCACCAAGACCCACTAATTTACCCGTGTTTAGTAAAGATGGAGAAGAACTAACCTAGTTC
TTCGACAAGAATTACGTCGCCATTGAGAGAATATTATCTACAACATAATTAATGCCGGTG
ATACATCCTAAATAAGCTAAATAAATAAAAGGAAAATGGATGGATGATTGCTTGAAAGTA
GTAAACGTCTTAGCCAACTTCCGCAAGAATAATGTCTCAATTGGTCTTGTGTTCTGTGAG
CAACTAGACACCGAGAATGAGGATTTGGCTTAATATTTTAAAGTCATTAAACAACCTATT
GACCTAGTAATGATTATGAATAGACTTTATACTAAACAATATCAACAGCCTCAGGAATTC
TGGAATGATCTTGGTTTGCTATTTAGAAATTGCAGAACTTACTACAAGAGTGCCAAGAGA
GGATTGAGAAAGCAGTGTGACACACTTAGGTGCTTAGCCTTCCATTTATATAATGATTGG
TACTAAGAGTAAAAACAAAGATTTGTGTCTGGAGTAGCCTTGCATCCAGTTCCTCCCGAG
CATCTTCAAAAGTAAAATCAACCATTTTTCAAAATTCCTGAATAAACAAATGACATGCCA
CAAAGACCCGAGAAAGAGAGAGGGAACTTAATCGTGAATCTTTCAAGTCTGCTAAACAAA
AATTAAAGCTCTTAAGAGCAGAAGAACATGTTTTAACCAGAGTAACAAGTAACCCAGACA
AATATAGTGCCATAATTATAGATAGAAGCTCCAGTGCCATAATAGTTGTAGATGCCATAA
AACTAATAATAGCAATAAATTATGCCACCTCCATCTAATCTGAACTAGCAACAACTCTTA
ATGCAATAGATGGCTCCCCCTCAATCATTGACACCAAACTCTCTCCAAAATCAGTAGAAC
TAATTGTATTAGCAAAATTTGATGCTTCAGTAATAGAAATAGCAACAGTAAATTCTATAA
TAATAGCAGCAACAACTCGGCTTCCCTCAGCAGAACTTTGGGTAATAGCAACCTGGAAGT
ATGATGCCACCTTCATCATTCAATTAACAGCAATTGAATTAGCCACCAAGTTTACCTTCA
TTGAACTAAATGATGAATCCACTTGGGCAAATGGGTGGAGTTAATGGTCTTGGAGCAAGT
CCATATATGGATTAAAGTTAGATGGGGTCTCAAGGTTAACCAGGGCAAATGCTTCCAGGA
TTTAACCAATTAAATCAATAACTTATGAACCCAATGTAACAAATTAGAGCACCCAATCAA
ATGATGAACTAGCAATAGGATTTTCTATAAAATCAGTAACTTGAATTACAAAAGCAACTG
GCCATGATGGATCCCTCGCTTCAGGTTTTGCAATAGCAATAAGATAAAAACCTGAATTTC
TTTAATCAAATGATGGGAATCTAACAACCATCACAGCTTGGATAAATGAATGAGTATCAA
ATGATGTAAATGATAGCACAGCAGTAGTAATAGGAACAGATCGCTTAGGCCTTGAGATAA
GGAATTGCAACAACTGGTTAACTACCTTCATTAAGCAGTATCTAAGGATTAAACTAAAAC
CAACCAGGAATGGGAGGTGGATTCTAGTTGCCTTCACTAAATGCTCTTGGTCAACTAAAT
CCATAAATTGGAGGTGGCTTTGATCCATTCTCGCAGTAAATGATGGGTCTCATGCAAAAT
CCAGGAGTAATGAACTCTATGATGCAGCAACCAGGTATGGGAGGAATGAAATACCAATAG
CAATTCCCTAGCACTATGAACTCAAGCAACGCTTATGATGAAATGTCTATGATGCTTAAT
AGTCTACAATAGTAATAATATCCCCAATAATTACCAAGCCTACAAGCAGGATTTAACCCG
TTTGGGCAAAATGATATGCCTTAAAACAATTAATTTATAGGCATGCAACAATAGATACCA
GGACAACTTCCAAGCTTCTAACAACATTAATAAAGCATGGGTGGAAATTAGTTTGGTTCA
AGGAATCAAAGCAATTCTATGAACTAAATTATACACTAGCAGCATCATTAATAGAAGCCA
TAATTGACTACAATCTTAGATCCTAACTTGATTTAACCAGACAATTTAGATCAATACAAT
GACAGACAACAAGATCCACCAGTACCTCCATGTATCATAGATCCTGGCGCACATGACCTC
TCTTGGATACTAGACCTGAATGAAAATCCACAATCACTAATGACATGTCCATATCTAACT
CAAGAGGAGATTTATGAGGCCATCTAATCAAAAAGTTTCGTTGATTAACTTTACCTTGTG
AAGTGGAAGAGTCTATCTTACAGTCAAAGTACTTGGGAGCCTGAATCTCTTATAAAGGGT
ATTTATGAAGAGAAAATAAGTGATTACTACAAATTCAATAGATCATTAGATCAAAATTAA
AGAGAAAAACTAGATTCTTTAATTAAGAATCACAAAAAGATGCTTAGATTTACTGAGAGA
AAGCATCAAGGTAAAAAGATGGATGCTAATCAAGAGGCAAATATGGCATTATAAGAGGCA
AAAATTAACAGATAACTCCTTAATCAGAAAATTCAAGAAATAATGGGGCCTGCTTTTTAT
TAGATTGTTTAATATAGTGAAAAAGACGGTATAGTCCCATAATTTAAAAGACCAACATAA
AAGCTTAAGGATTATCAAATAACAGGTTTAAATTGGCTAATTAGAGCTTGGCACTCTCAC
AGAAATATAGTATTAGCTGACGAAATGGGACTGGGTAAAACAATTATGACATTGGCATTA
TTCGAGCATTTTAACAGAGTTTATCGACTAAAAGGACCCTACCTGATTTTGGCACCGCTA
ACAACTCTTGAGCACTGGAAGAGAATTGCAGAAGAGTGGACAACTCTAAACAGCATTCTC
TATTACGATCCTGGAAGTGCAGAAGGAAGAAGTGAACTAAGATATTGGGAATGGTTCTAT
ACTGACATCACTTATAAAGGGTAGATCACATAGAAGTCAGAACTGTTTAAATTTAACATA
ATAATTACCTCCTTTGAAGTATTTATGCAAGACTTAAACCCCATTATCTAAGAAATCCCT
TTCATGTATATTGTCGTAGATGAAGCCCATAGACTTAAGAACAAGTAAGCAAAGACTTTG
AAACTACTAAAAGATCATCCATGCAAACGCATTTTACTACTTACTGGTACTCCAGTTTAG
AATAACACTAAGGAGCTTTGGACTTTATTAAATTACATTGAACCTGAGAAATTTCATTCA
CAGGATGACTTCATGGAGAGCTATGGTAATTTGGAAAACTACGAATAGATCTAAAAACTG
CATTAGATGATTAAGCCCCATTTCTTGCGTAGATTGAAAGAAGAAGTAGACAACAGCATC
CCTCCACTATAAGAAACAGTGATTGAAGTTGGGTTGACAACTGTCCAGAACACTTATTAT
AAGGGTATCTATGGTGAAAATAGAATGATGTTGGCAAAGTTCGGTACTAATTCTATCAAG
ACATCACAACTAAATAATATTGATGTTCAACTTAGAAAATGCTGCAATCATTTATTCTTA
CTTAAGGGAGTTGAAGAGGAACTTACTAAGGATTGTAGAACTGAAGAAGATATTTACAAG
AAACTACTTGAATCATCAGGTAAGCTGATGTTGCTTGATAAGTTCATTGAAAAATTCAAA
AAAGAAAATCATAAGATGTTGATATTCTCATAGTTTAAACGCATGCTAGATATCATAGAA
CTGTATTTGAAGATGAAAGCTGTATCCTATGAAAAGCTTACTGGTAGTGTTAAGACTCAA
GATAGAATAAGTGCTATTTAAAGGTTCAATGATGATAAAACATTTGGAGTGTTCTTACTG
ACCACAAGAGCTGGTGGTTTAGGCATTAACTTGACATCGGCAAGAGTTGTCATTATCTTT
GATTCAGACTGGAACCCTTAAAACGATCTACAAGCTATCGCCAGAGCCCACAGAATCGGC
TAGTAGTTTGAGGTGCAAGTCTTCAGACTTATAACTTCAAAGACCTACGAAGAGTAGATG
TTTGAGAGAGCGAGTAAAAAACTGGGTATGGAGTAAGCATTGTTTAGTAAGGGTGCTTTC
CATCAAAATGATGATGTTGAATTCTCTTAATTACATTTAAGGGGCTTCCAAGAATTGAAG
CAAGATTCAAAAGAGATAGAACATCTGCTTAAATATGGTGCTTATGCATTTATGGATGAA
AATTAATAAGATGAGGACCCAGTCAATTTCAACAAGGATATTGATGAAATCTTAGCAACT
GGAAAGAAGAAGGAGTTTGTGTATAGTAAAGGTATATATACCTTGCAGAAGAGTACTTTT
AATGCTGCCAAATATGAAAATCTACCTGATTTGGATGACCCAGATTTCTGGAATAAAGCC
CTTGGCTCTATTATGTCGATAGGTATGATGGAGAAGAGATTCAAAAAGGAAAAGAAAGAA
ATGGGTAAAAGCGAGAAAATGTAGAAAGAATTCTTCAAAGATTTGGAAATAGTTTTCAAT
GATTTTCTTGATGCTAAGTTTGACCCCAAAACATCTGCAGCAAGCAAAAAGTAGTTCGAA
TCAGATGAGGAAAAATTGAGAGAAATATTAAAGAAAATGATTAAACTAAGTGGAATGAAG
TTGCTATATGTTGAGAAGTGCAAAGAATGGATGAGGGAGATGCTTAGAACAAATAAGAGA
AAGAAACCATTGCAAACTATGTTTCAAGATGACAATGAAAACCCTTAAAAATAACCACCT
GATCATATTGGTGTATTCAACGAAGATGAAGAATAAGAGTTGAACATCGAAGAAGACGAT
ATTATCCTTTATGATAGTGATGATGAACTTAACAGGAACAGAACACTAAGAAAAAGAAAC
CCTGTTGTACAATAGCCTCAACCTAAACTTGACTTTGACGAACCACAAACAAAAGGGAAA
AGAGGTAGAAAACCCAAAAATGCTAATTTAGTTCAATAAAAAGATATCGAAGAGAGTAAT
GAGTTTGGTGACGAAGAAGAAGATAACTATGGTGATGAGGAAGATAGAGATTATAATGAA
AAAGGGAACAAGAGAGGCCCATACAACAAGGATGGTGACTACGGAGATAGTGATGATGGC
GAGGGGTATGGACTTCGTAATCAGAGAAAGCGTCAGAAAACCGGAAGAGAAAATGACATG
ATGAGTCAGTAAAACAACTATAGCAGCAATCAAAAGCACTTGCCAAAAATCAATGACTAG
ATAGTTAAGCGAAATGAAAAGAACGGAATCGTATGTTCTTACTGTCTGCAACCTGAAAGT
ATTGGTAAGATCTGTTCATATTTCTGCCAAGGTTATTGCCAGAGATTCTTCCATGATGAA
TGTAAAGATCTAATGTTACAATCTAATAATGGAGAAGAATCTAAACGCAGACATAGAATG
AATTAAAACTAAGCCACATGGTAATGCGATGACTGCTTGGACAATAAAGCCATTTGCTTC
TGCTGCAAGATCAAAGGTCAGATACTCCTGTTTCCTAAGAAAGGTAAGCCTAAGGCTGCT
GGGTATCCTGACATGCAAATAAACAGTAACAGCCTTCTAGGTGGTGATGACGACAATTTA
GCTGAAGATGACAATGACATTGATAACAACGATTTGGACGAAATGAATAAGGATCAAGAT
TACGGTGATGAAGCTGATGATATGGAATTGGATGGGATTGAACATTTGAAAGTTCAAGAG
ACAAATCTAAACGAAGAAAATCAACTGTTAGAAGAAGTCATTCCAGCAGAAGACTAACCG
ATCTAAAACCAAGAAGAACAGGATATCAAACCTGATGGCTATATTGTCGAACAGGAAGTT
CAAATGGAAGAGCAAGATTTGGAAAAAGATTGCATTGATGATTAAGTCATTGCTGATGAA
GATAAGGATCAAAAGCTAGAGAAACAAGATTTTGATGATAAAGATAAATCTGCATTATTA
GAAGAAGATTAAGTAAAAAAAGACCTCATTAAAGTTGAAAATCAAAACGAAGATTAAGAG
AACATAGTAGAGCATGTGGATATAAATCCGGATGAATAACCTTCCTTCAAAAATGACCAC
TCTACAAAGATAGTTTTGTCAAATCTGGCATTAATGCCAATGAAAGACAGCGAGGAAATT
AAAGTTAACAGAAACATACCCTCACCAGAGCCTGAGCCAAATGACAAGCACTTTGTAGTC
AGATGCACTCTAGGTGGTTGCTTCAAATACTATCATGTTGATTGTGTGTATCAAAACAAA
AATGTGTCATGCATCAACTCAATGAAGGTGCAAAGATTCAGATGTCCCTTACATTATTGT
GAAATATGTCAAGCTTCTGGTGATAGTGTATTAATTGTTCAATGTGTGAATTGTCCAACT
GCTTATCACTTGAAGTGCCTTCCTCAAGATTTAAAAGCTATCAGACTCACTAAAAAGTAC
ATTATTTGTGGGAAACATGAGCTAAGCCCAGAGAACTATCCTAAATATGAAGAGAAATCT
GGAGCCTATGTCTCAGTAAGAGGTTTAAACAATCATAGTGGAGGAGCGAATGGCAGTTAA
TTGGGTATTTCAAAGAGTGATAAGAAGAACAATAAAAATAAGAAGTTAAAGAAGCGAGGA
AGAAAGCCAAAGAACATGATTTATTAAGACAACGAAGATGGAAGTGAAGATGACGAGATG
AATGAAGAGTTCTAAGATCAATAACCACTTCAATTTAGCGAAATAAATAAAATCGGACAT
GCCCATACTCCAATCAGTCATAGTGGTTAGTTTGGTTCGGTGCAAATAAAACTAGAACCA
AACCACAAAGAATTCTCAAGTGGCAATATGCATCTGGTAGGTAAGCAATCACAGTTATAG
TATGAAGATAAAATGGTAAGCAGCAGCAGTAATCACATTTAGATTCACAGAAGGAACTCG
TCAAGTTAAGATATCAAAAGTGAATACTAGAAGGAATCAGCTGCTAGCACTAATGTTAAT
GCAACTGGTTCTAAGCAGCAGCAATATAAACCATTATTCACAGTCGAGAAGAGCACTTCA
AGAAATGCACAATGA


>Contig11634.0.g75(protein)
MRTKRKNYKYDSDDFENGDYEEDDFDEEEDDFDEDDQQDQSHQESDYDHPNNGGIDGKKS
GGNGKQTKQTRKNKKEEQEVEHEDSYEDEDPFSPEIDQILADKEVEIQAPVTQAQVSNQQ
NPNQIKSTRNATLLPQTKKSFMFLVKFTDQSYLHVRWMEESELEEYSYRAKQKIRRYFNA
KEKKRIIQEQIQRQVIAFKPIKNHHFSDDEEEEEEDEDAAIKGITLPDLPIIEEIAVAEE
APRPTNLPVFSKDGEELTQFFDKNYVAIERILSTTQLMPVIHPKQAKQIKGKWMDDCLKV
VNVLANFRKNNVSIGLVFCEQLDTENEDLAQYFKVIKQPIDLVMIMNRLYTKQYQQPQEF
WNDLGLLFRNCRTYYKSAKRGLRKQCDTLRCLAFHLYNDWYQEQKQRFVSGVALHPVPPE
HLQKQNQPFFKIPEQTNDMPQRPEKERGNLIVNLSSLLNKNQSSQEQKNMFQPEQQVTQT
NIVPQLQIEAPVPQQLQMPQNQQQQQIMPPPSNLNQQQLLMQQMAPPQSLTPNSLQNQQN
QLYQQNLMLQQQKQQQQILQQQQQQLGFPQQNFGQQQPGSMMPPSSFNQQQLNQPPSLPS
LNQMMNPLGQMGGVNGLGASPYMDQSQMGSQGQPGQMLPGFNQLNQQLMNPMQQIRAPNQ
MMNQQQDFLQNQQLELQKQLAMMDPSLQVLQQQQDKNLNFFNQMMGIQQPSQLGQMNEYQ
MMQMIAQQQQQEQIAQALRQGIATTGQLPSLSSIQGLNQNQPGMGGGFQLPSLNALGQLN
PQIGGGFDPFSQQMMGLMQNPGVMNSMMQQPGMGGMKYQQQFPSTMNSSNAYDEMSMMLN
SLQQQQYPQQLPSLQAGFNPFGQNDMPQNNQFIGMQQQIPGQLPSFQQHQQSMGGNQFGS
RNQSNSMNQIIHQQHHQQKPQLTTILDPNLIQPDNLDQYNDRQQDPPVPPCIIDPGAHDL
SWILDLNENPQSLMTCPYLTQEEIYEAIQSKSFVDQLYLVKWKSLSYSQSTWEPESLIKG
IYEEKISDYYKFNRSLDQNQREKLDSLIKNHKKMLRFTERKHQGKKMDANQEANMALQEA
KINRQLLNQKIQEIMGPAFYQIVQYSEKDGIVPQFKRPTQKLKDYQITGLNWLIRAWHSH
RNIVLADEMGLGKTIMTLALFEHFNRVYRLKGPYLILAPLTTLEHWKRIAEEWTTLNSIL
YYDPGSAEGRSELRYWEWFYTDITYKGQITQKSELFKFNIIITSFEVFMQDLNPIIQEIP
FMYIVVDEAHRLKNKQAKTLKLLKDHPCKRILLLTGTPVQNNTKELWTLLNYIEPEKFHS
QDDFMESYGNLENYEQIQKLHQMIKPHFLRRLKEEVDNSIPPLQETVIEVGLTTVQNTYY
KGIYGENRMMLAKFGTNSIKTSQLNNIDVQLRKCCNHLFLLKGVEEELTKDCRTEEDIYK
KLLESSGKLMLLDKFIEKFKKENHKMLIFSQFKRMLDIIELYLKMKAVSYEKLTGSVKTQ
DRISAIQRFNDDKTFGVFLLTTRAGGLGINLTSARVVIIFDSDWNPQNDLQAIARAHRIG
QQFEVQVFRLITSKTYEEQMFERASKKLGMEQALFSKGAFHQNDDVEFSQLHLRGFQELK
QDSKEIEHLLKYGAYAFMDENQQDEDPVNFNKDIDEILATGKKKEFVYSKGIYTLQKSTF
NAAKYENLPDLDDPDFWNKALGSIMSIGMMEKRFKKEKKEMGKSEKMQKEFFKDLEIVFN
DFLDAKFDPKTSAASKKQFESDEEKLREILKKMIKLSGMKLLYVEKCKEWMREMLRTNKR
KKPLQTMFQDDNENPQKQPPDHIGVFNEDEEQELNIEEDDIILYDSDDELNRNRTLRKRN
PVVQQPQPKLDFDEPQTKGKRGRKPKNANLVQQKDIEESNEFGDEEEDNYGDEEDRDYNE
KGNKRGPYNKDGDYGDSDDGEGYGLRNQRKRQKTGRENDMMSQQNNYSSNQKHLPKINDQ
IVKRNEKNGIVCSYCLQPESIGKICSYFCQGYCQRFFHDECKDLMLQSNNGEESKRRHRM
NQNQATWQCDDCLDNKAICFCCKIKGQILLFPKKGKPKAAGYPDMQINSNSLLGGDDDNL
AEDDNDIDNNDLDEMNKDQDYGDEADDMELDGIEHLKVQETNLNEENQLLEEVIPAEDQP
IQNQEEQDIKPDGYIVEQEVQMEEQDLEKDCIDDQVIADEDKDQKLEKQDFDDKDKSALL
EEDQVKKDLIKVENQNEDQENIVEHVDINPDEQPSFKNDHSTKIVLSNLALMPMKDSEEI
KVNRNIPSPEPEPNDKHFVVRCTLGGCFKYYHVDCVYQNKNVSCINSMKVQRFRCPLHYC
EICQASGDSVLIVQCVNCPTAYHLKCLPQDLKAIRLTKKYIICGKHELSPENYPKYEEKS
GAYVSVRGLNNHSGGANGSQLGISKSDKKNNKNKKLKKRGRKPKNMIYQDNEDGSEDDEM
NEEFQDQQPLQFSEINKIGHAHTPISHSGQFGSVQIKLEPNHKEFSSGNMHLVGKQSQLQ
YEDKMVSSSSNHIQIHRRNSSSQDIKSEYQKESAASTNVNATGSKQQQYKPLFTVEKSTS
RNAQ