Identifiers and Description

Gene Model Identifier

Contig19235.0.g45

Standard Name

CHCH1b

Aliases

Contig19235_0_g45

Description

RNA helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

  • intrinsic component of endoplasmic reticulum membrane (IEA) | GO:0031227

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001382000.000000000007000776811212012hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19235.0.g45(coding)
ATGACAGAAGAATTTTGGCAATCTTACAAGAAGAAAAAAGATCTTACTTAAACGAACACT
CTATTTAAAGGAATAGCTGATGGGATTAGATAAGAATAAATTAGAGATAAACATCCAGAT
GAATTGTATGCAATATGTAGGACGGACAATAATTATTGGCGGCACTATAGAGCCTCGCCC
AAATTAACAATAGACGAGTTATCTATGATGATTTGCAAAGAAGTGGGCTGTGATTTATCT
TATTGTCAAAATTTGATGTGGAAACCCAAAACACCCAATCAAAATATCTCAGACTGCTCG
GACTAGTATAATTCATTCCGTGAGTGCGTTGTTAGAGAGAAAAAGATTTTTAGATCAATA
GTTGGAAGTATAGACACTAAAGCTAACCCCATGGCTATTCCCGATTATCTAGAGAAGCAT
TTCAAGGAAAAGGAAGCATTAAAGCGCAAGAAGTAGATGATGGGAGGAGACGAAGACGAA
TTAAAAGCAAAAATAAGAAAAGTAGAGGAAGATTCTCATATTTTAAGAGCTAAAGTCATA
GACACCCAATAATTCTAGAAATAGAAGCAGCAGATCGTAATGGGCTAAAAAGAAGAGGAA
TACATCTGA


>Contig19235.0.g45(protein)
MTEEFWQSYKKKKDLTQTNTLFKGIADGIRQEQIRDKHPDELYAICRTDNNYWRHYRASP
KLTIDELSMMICKEVGCDLSYCQNLMWKPKTPNQNISDCSDQYNSFRECVVREKKIFRSI
VGSIDTKANPMAIPDYLEKHFKEKEALKRKKQMMGGDEDELKAKIRKVEEDSHILRAKVI
DTQQFQKQKQQIVMGQKEEEYI