Identifiers and Description

Gene Model Identifier

Contig10022.0.g42

Standard Name

CHCH1a

Aliases

Contig10022_0_g42

Description

CHCH domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001382000.0000000000005000841553255702hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10022.0.g42(coding)
ATGACAGAAGAATTTTGGTAAAGTTAGAAAAAGAAACATGAAAGCAATCCTGTTAATGTC
AATCCACTCCTAGTTTAAACAGAGAAAGATGCTAAATCTATAGCATCTGACAAACATCCA
AAAGCACTATATGCTGAATGTTTGAAGCAATCAACTTATTGGACACATTATGCAGCCTCC
CCTAAATTGTCCATAGATGATATGGCAATGATGCTCTGCAGAGACATAGGTTGTGAAGTT
AACTATTGTGGATTAGTAAAGAAGAGTTAACCTATGGAATGGGAAGGAAGCAGTGATTGT
GTAGATGAGATTAAAAATTTCAGTAACTGTATGACTCAGGAGAGAAGGAGGTATTAATGG
CAAGAGATCAAACCACCAATGTTCGATTACATTTAGAACAGACTTGAGGAAAAGAGAAAA
AATAAGAAATTCGCAAACATGTTTACGTAACAAGAATTAGAAGCTATAGAAAAACTAAAA
CAGGAAGACAAGCAACAACTCGAAGAAAAGAGACAAAAGGAGAAACAACTCACATCATGA


>Contig10022.0.g42(protein)
MTEEFWQSQKKKHESNPVNVNPLLVQTEKDAKSIASDKHPKALYAECLKQSTYWTHYAAS
PKLSIDDMAMMLCRDIGCEVNYCGLVKKSQPMEWEGSSDCVDEIKNFSNCMTQERRRYQW
QEIKPPMFDYIQNRLEEKRKNKKFANMFTQQELEAIEKLKQEDKQQLEEKRQKEKQLTS