Identifiers and Description

Gene Model Identifier

Contig22253.0.g49

Standard Name

CHAF1B

Aliases

Contig22253_0_g49

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002194202.0007467515522948e-59hypothetical protein
SGDYML102W9.999888128184441e-42CAC2 SGDID:S000004570, Chr XII
I from 68294-69700, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22253.0.g49(coding)
ATGCAAGTGGAAATCCCGCAAATTTACTGGCATGATAACAGTGCTCGTATAATGTCTATC
GATGTCTATCCCAACTCAAATTACTTCGCAACTGCCTCAGTTGTATCAGAAGATGACTCA
GGAATCAGAATTTGGGAGATGATAGCTGAAAACAATGAGAAGCAATAATTTTCACCCGGT
AATGCTTCTGTGGCGTCAACTGTGACTCAAAAGTATAAAATTGAGTACAGATATGATTTG
CAAGGAGGGCATACTTCAACAATCAATGTAGTCAGGTTTTCACCTAATGGTCAGTATTTG
GCTTCTGGTTCTGATGACTAAATGGTAATCATTTGGACTTTAAAGAGCGCTCCTCTTGAA
TTTGGTAAAATGGAGGAGGCCATTCAATGGGGCCATCCTAGATAATTGAGAGGTCATGTC
GGAGATGTTATGGATTTATGCTGGTCAAAATAGAATGGCCTAAATGATCAAAGCTGTTAC
TTGGTCTCGTGTTCAATCGATGGCACTGCTATTCTTTGGAATATTGGCGGCAATAAGTTC
AGCAAAATATAGACGTTCGATGGCCACAAGAAACTTGTTCAAGGAATAAGTATGGATCCA
TTAATGAGATACATTGTTACCATGAGTAGTGACAGTTCAGTTAGAGGATATAAGAATAGA
AAGCTGAAGACTTAGTTGCAATTCTTCCATAAATTTACTTTGAGGAACAGAGAGGAAGAA
ATTGAATAGCAGGAGGATGGATTCGGATAACTTTAACTTGAAACAACTGAGGCAGACACT
AATGCTTAAGAAAACAACAAAATAAAGAAAAGCTCTCATAGAATGTTTCTTGATGATGTA
GAGTATTTGTGTTTTGTGAGAAGACTCTCTTGGAGCCCAGATGGCACTTTCCTTTTGACT
CCTGCTTCAGTTTATTAAGATATTTAGACTGAATCTAAGAATTTATATACAGTCTATGGA
TTCTTGAAGTCTGACATCACTCAACCAATTTTTATGCTGCCAGGGATTAAATCCTATGCT
ACTTGCGTAAAATTCAACCCCTTTTTGTATAAGAAAGATGCCAACAAAGTTTATACCGAA
GAAAATCCTGCTCTTTTGGACTTACCTTACCAGATGTTCTTTGCAATCGGAACAACAGAT
TAAGTGCTTATCTACTCAACCGACAGTATTTTCCCAATATCAATTATTGGCAACACTCAT
TTTGCCCCAATTAACGATTTATCTTGGATAATAACCAATGACTAAAAGGTGAAGCTTATT
GCAGCTTCCAGTGATGGTTTCTGTTCTATAATCTCCTTTGATATTTAAGAAAATACTGGC
TTGACGATATTGGGTGAGCGACTACATATAAGTGAGATGCCAGAAAAATTGAGAGGAATT
TATGAAGCCTATGAAAGCGTTAGCTTCAAGAAGTTTGAGATGGAAGCAAGAGAAAGAAGC
AAAAATAGTTAATTCAAAGCAGTTTCATTCAAGTCTAAGAATGCTACTGTAACAACTACC
ACAGCAAATAATAATAACAATAATCAACTGAGTGTGCCACCATTATCAGGAGTTAATAGA
GATAGCAGCAATCAATAAGAGTAAAAGGAAGATGTGGTTATGATTGAAACATGA


>Contig22253.0.g49(protein)
MQVEIPQIYWHDNSARIMSIDVYPNSNYFATASVVSEDDSGIRIWEMIAENNEKQQFSPG
NASVASTVTQKYKIEYRYDLQGGHTSTINVVRFSPNGQYLASGSDDQMVIIWTLKSAPLE
FGKMEEAIQWGHPRQLRGHVGDVMDLCWSKQNGLNDQSCYLVSCSIDGTAILWNIGGNKF
SKIQTFDGHKKLVQGISMDPLMRYIVTMSSDSSVRGYKNRKLKTQLQFFHKFTLRNREEE
IEQQEDGFGQLQLETTEADTNAQENNKIKKSSHRMFLDDVEYLCFVRRLSWSPDGTFLLT
PASVYQDIQTESKNLYTVYGFLKSDITQPIFMLPGIKSYATCVKFNPFLYKKDANKVYTE
ENPALLDLPYQMFFAIGTTDQVLIYSTDSIFPISIIGNTHFAPINDLSWIITNDQKVKLI
AASSDGFCSIISFDIQENTGLTILGERLHISEMPEKLRGIYEAYESVSFKKFEMEARERS
KNSQFKAVSFKSKNATVTTTTANNNNNNQLSVPPLSGVNRDSSNQQEQKEDVVMIET