Identifiers and Description

Gene Model Identifier

Contig9774.0.g97

Standard Name

CEPP4c

Aliases

Contig9774_0_g97

Description

Phage integrase, N-terminal SAM-like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam02899 ) Phage integrase, N-terminal SAM-like domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004464505.0006177757215735e-177hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9774.0.g97(coding)
ATGGCAACTGCTGCGAACGACGGAGACATAAAAAACGTTCAGAACACGGAGGCATTTAAC
ATCCTCCAAGACTTGCAGAAATAAGGGCAACTCTCTTCAGATACTGCTGAAGCATACAGA
CAGAGATTCTATTAATTGCATGAGGTGCTTGTTACAAACATGGAAAATGAGCAGTAACTT
ATGAAACGTGCCAGAGCACTCCAAAAGGAACTGCAAAATGAGGTGTTGAAACTTGAGAAA
GCTCAGTAATAGTAGAAGTAAAATGAGGAGACACTTAAGGAACTCAATAACACCATTAAT
GATGTGAGAAGAACCATTGAGACTATTGAAGAGCGAAGGCAAGTATTGAGACAGGAAATT
CACGTGCTTGAAAACCAAAAATTGGACTTGGAGAGTGACATAAATGTCAAGCAAACACAA
GAACGTGAAAGAATCATCCCAGAGATAGAGAGAATGGAAGCTTTGATTGCTGAATTATAG
AATGAAATTTCTCAAACTGATTTCAAGATATAGAAAGAGGAAAGAGCCAATACAGAAATT
GAAGAGAAACTAACTGTCATGGATAAGGAGAAGGACGACTACAAGGAGAAAATAGAGTCG
TTGTAGTAGGACTTCTTGAAGGAGCGTGATGAGCCCAACCGCCTAGGCAAAGGCAATGAA
AACTTAAAGAAGGCTGTGGAGCATTTGAGAAGTGACTTGGAAAAGCTGCAGAGTGAGAAC
AAAACTGTGGATTTGCAATTAGAATCTGAATAGAAAGCCAAGAAGTAATGTGAAGAGTAG
AGAGAAAACTTCAAAAAAGAAATGCAAGATAAGGAAGTGAAGATTAAAGAGCTAGACACA
AACATAAAACGCCTGAGAGAGCTGAGTGACACCATAAACAAGGAAATATTCAGAATCACT
GAGGGCAGAGTGGTCATTGAAACTCAGATTAAAGTGCTTGAGAGTGGAAAGAAAAGACAG
CAGGAGAAGATTAATCACTACAACAAGCGCATTGATGATGAGAAGAAGATGTACAAGAAG
ATTGAATACGAGAACACCAACTTAATTAACAATATAAAAGAGTTGGATACCACAATACAC
ACTACTCATAAATTCCTTGAAGAGAAGCGTAAGGAAGCTGAGCAGTTACTGGTTTATAAG
AAAAACCTGGAAGAAGAACAGCAGATATTTGTGGGTTAACTAGTTAAGAAGGGTCTAGAG
GAGAAGAGCATGTAAGCTAAAATCGTCAAGATTAGATCAGACATATTGCATCACGAGCAG
GATGTTAAGAAGTTTGAAGAGGAGGAAAGTAAGTGGCTTGAGGAAATTAAGTTCTTATCA
ACTATTAGAGAGAAAATGGCAAGAACTGCCTCATAAGCTATGGCTTAGGCTAGAGAGACC
AAAGAAGAACTTAAAGTTAAGGAGTTACTGATTTTAGACTTAACCAAGAAGCAGCAAGAA
ACTGAATTTAGACTTAATTCGTTTATCGCTTTTTCCTAAGATCTGGCTGAAATGAAGGAA
CGTATTAAAATTCTCCAAAATGAAGTGGAAATCTTAAGGAATGAGTCAAGTGAAAAAGAT
CGAGCGCTGGTTGACATCAGACATTAAGTCTAAAAAGAAATCTACAAGAGAGATTCATTA
AGAGCTGAACTTAACAAAAAAGACTTCGTTTACAAGAGCAAGTAAAGCATCATCGGACAG
AAGATCAATGAAGGAGATAAACTCAATTTGATCATTAATAGTCTACAGAAAGAAATGAAC
GATTTGATATATAAATATGAGATGGCTTGTGAGTCCAGAAACTACATGGGTATTTAGTTA
ATTGACAGAAATGATGAATTATGTATTCTCTATGAAAAATCCAACATTCAAGAAAACATC
CTCAAGGACGGCGAGTAGCAAATCAGACAAAAAGAAGAAGAAATTCGCATGATAAATTTA
GAACTTAAAGAGAGGTAGAGACAACTGGAAGTTGTCAGAAAATAGATTCCAGATGTGCCT
TAATTAGCTGAGAGTGTCATTGACCTCAAGAAAAAGCTAGACAAGGAGAGAGAAAAAGTT
GAGCAGCTCTCAGAAATGTTGGAGAATCCAGGGAAACATCCTAAATGGAGAGACCTTGGC
GGAGAAGACCCAGATTAAGAGGCCTTATAGGCTAAGATTCAAGTGCTTGAAGAGAGACTT
AACAATAAAAAGGAAAGCTTACTTGAGAAAGAACTTGTTTATGAGGAAGTCTCAAATCTT
GCTGAGAAACTTAGAACTTAAGCACTCGATGGCAGAAAAGGCACACTTGAAATTGCTGAG
AAAATTAACGAATATAAGGCTAGAACTACCGAACTTTCAAGAAAAATGTTGGCTACAGTC
TCAGAACTATCTATGTTCTAATCTAAAGCCTTGAAACTTTAATAAGAAAAAGAAGAGAAG
GAAACTGTGATCGAAGAGTCAATGAGAAGAATGGACACAGGTTTACCACCTACAGACACC
TGCGAGCAAGAATGGGAAAAAATAGAGAGAAACAGACTCAGAGAATAATCAGATAGAGAG
GAAAGATCTCAGAGAAAAATGCTAGAGCAACAATTGCCACCTACAGGTGTTAAAACCACT
GCTTTACCTAGACCTAATTCTTACATGCCATCAGATATCCAAATTCCTAAACCCTATGGT
TCTTACGCTCCATTTATGCCAAGCGAGCCAGGAGCTTCTATGCGTCACATTGTAAAGCCA
AAGATCAGAGAGATAGAATATTGA


>Contig9774.0.g97(protein)
MATAANDGDIKNVQNTEAFNILQDLQKQGQLSSDTAEAYRQRFYQLHEVLVTNMENEQQL
MKRARALQKELQNEVLKLEKAQQQQKQNEETLKELNNTINDVRRTIETIEERRQVLRQEI
HVLENQKLDLESDINVKQTQERERIIPEIERMEALIAELQNEISQTDFKIQKEERANTEI
EEKLTVMDKEKDDYKEKIESLQQDFLKERDEPNRLGKGNENLKKAVEHLRSDLEKLQSEN
KTVDLQLESEQKAKKQCEEQRENFKKEMQDKEVKIKELDTNIKRLRELSDTINKEIFRIT
EGRVVIETQIKVLESGKKRQQEKINHYNKRIDDEKKMYKKIEYENTNLINNIKELDTTIH
TTHKFLEEKRKEAEQLLVYKKNLEEEQQIFVGQLVKKGLEEKSMQAKIVKIRSDILHHEQ
DVKKFEEEESKWLEEIKFLSTIREKMARTASQAMAQARETKEELKVKELLILDLTKKQQE
TEFRLNSFIAFSQDLAEMKERIKILQNEVEILRNESSEKDRALVDIRHQVQKEIYKRDSL
RAELNKKDFVYKSKQSIIGQKINEGDKLNLIINSLQKEMNDLIYKYEMACESRNYMGIQL
IDRNDELCILYEKSNIQENILKDGEQQIRQKEEEIRMINLELKERQRQLEVVRKQIPDVP
QLAESVIDLKKKLDKEREKVEQLSEMLENPGKHPKWRDLGGEDPDQEALQAKIQVLEERL
NNKKESLLEKELVYEEVSNLAEKLRTQALDGRKGTLEIAEKINEYKARTTELSRKMLATV
SELSMFQSKALKLQQEKEEKETVIEESMRRMDTGLPPTDTCEQEWEKIERNRLREQSDRE
ERSQRKMLEQQLPPTGVKTTALPRPNSYMPSDIQIPKPYGSYAPFMPSEPGASMRHIVKP
KIREIEY