Identifiers and Description

Gene Model Identifier

Contig1230.1.g115

Standard Name

CEP44a

Aliases

Contig1230_1_g115

Description

MutS domain V

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1230.1.g115(coding)
ATGAAAAACGAGGTTTTGAAGCAACATTAAACCCATATTTCTTCCACACAAATGCAATTG
TAGTCTAATAATAATAACTCAAATCAGATTCCACAGTCAATTCATAGCTAGCCTACATAG
TCACCATCAAGAGGGGGTCTGAACTTAAATACATAAATTGAGAGATTCAAGCAAGAATTG
TCTTCGAGTAGATATAAAAGAAGCCTAGATTTAGATAAAGTGCAAAGAGGCCACCCCAGT
GTATACCTACCCATAATTCATTTCTACCTGCTCTCCTATTCCAAGCCAGTCGCTCAGAAC
ATCCGCGACAAGGGTTTTGAGTTCCATGCATAGAATGATTATGAATTTGTGACTACCCTT
TTCAATGTACTGAATCAATTATTTACATACAAGCCACCATTTAACATTGATTAATTCTTT
CAGCACGGCATGCCTGATAGGAAACTAGGGTTTGTCCTAGACATAATATCGTTGGTTAAA
TCTAAGAATGCAATATTGAATAAGAGAAGTAGCAGTTAAAAACCTAAGTCTGTCACTTTT
AAAGATGAAGAAGGAGGTTAAGTGGAGGTAGAAAAACAATAAAATCATCTTAATGAGAGA
CAAAGCAGGTCTAGAGGACCCCACAATGGATCTCAGCAGTAACAAATAGATATGTATGCA
ACTTTAAACCCAGCTAAGGGATTCAATAAAAACGATTTAATCCTAGCTGAAAACTAACCA
AACCTCACAAACCAACTATCTCACGGCAAAGAACGCTAATCCTCAAGATCAAGGCCTTCA
AATATTGGAAACTTTAGTAATTAGGTTTAAAGCCAAAATCCAGATTGCTCAGATGATTAA
AATTAGAAAAAAGAGCAATTAATGCGAAGTCCAAAGTATCAATAAGACTCCAGACCTACC
AGCTCTTAATACAACTCAAGATCTAGGTAACAACAACCTATAAACGGTAATTAAGCAGGA
AATAATTCTTCATAAAATTAGTCACATTCAATAATGATGAAGCATTATTCAAGTAAACCA
CCTGTAACTAACAACAATAAAATTCCAATTTAATAAACTTAGAATGTTAGCATTACAGGA
AGTAATATGAATGGGGATTCTACATGCTAATCGCAGTAAAATACTCATAGAGTAGCACCT
GTTCAAAACGGAAAAGAATCAATCCATAGTACAATCTAGAAGAACCACAATAATTTAAGC
TCCCCAAGCCATGATTAATCAAAGCACCGCCCAAACTAAAACTTTAATAATAATATGCAA
CAAGATTGTTTAGACCCCTTAAACTCACAGAGAAATTAAAATTCAAACATAAAATTGAGA
AAACCTTCAATCTAAGCCAATAATTACATTTTGGAAGATAGTAGTGGAGATTAAAGTTAA
AGATCTTCAACTGAGAGTCATAATAACTCCAAAATTTTATAGAAAATTAGAGAGAAACAG
TAACATATTTCACAATAATAGAAAACTTCTATTCCAACAAGCAATAGTGTTATTAAAAAT
CTAAATAATGAACCAATATAAGCAAAATGCTTTACAAAGAATGATTAGATTTAATAAATT
GAATAACAGAAATAAGAAAAGTAAAATGCTGATTTGGCATTGTTAATAAGTGGGCTTAGT
GAGCAACTTAAAACGATGAATATGAAATTTGATAATTTTCAAAAAACAGTAGACTCAAAG
TTTGATTAAGTCCTGCACTAAAATCAATCTCTAGAATAAAAAGTGATAAAGATTGAGCAC
AAATTTAGAAAGTTGAAGGATAAAATGATAAAAAAGGATTCAGTTGCTAGATCAGGTTCA
AAGCGTCGAGGCCATTCAGGTCATCGACATGAAAAAGAAAATAATGCAGAAGGCAATCAA
GTTTTAGCTTCTCCCTCTCATCATAACAACTAAAAGATGTTGAACCAAAAACCAAGTAGC
AATTAGGTATATAGTTACTAAGTTCCTAACGCAATCAGTTCAACTTACCAACCTTATCAA
AGCAGACATGCTCCCTCTGTTTAGTATTAAAATGGTGCCGCAAACGGTTCAAATGTAATA
AATCAGCTTTTAGTAGAGCAAACAGTTGCTTAATAAAATCTGAGGTAGCCTTCTATATTA
CACTAAAACTCTGATAAGCCATAAATACAGAACTAAGTTCCCTCAAATTCAACGACAAAC
AATTCCACTGCTCAAAATAGCAGCTAAAACACAATGCGGTCCCTTGGCCATAAAACTTCA
ATACCTGGGAACAGTGGATCATCCTACTCAATTGACTAGAATCCCATGCATAATTAATTT
AGTAATAATCATGATACAGTAAAGAATATAGCTGTTCATAGTGGAAACAATTCTCAAAAA
TTGGATTCTCAATTTTCCTCATTAACTACTGTAAAACAGGGATCAACTATTAGTAATAAC
AATTATGTGCCTAACACCACTACAACGCATATCTAACCACCTAATTTGATTCATTCCAAG
TATTAATACTAATAGCAATAACCCTCAAGCTAAAACTCTAGTCAATAATAAAGCAGTAAT
CAGTAAGATGAATATATTCAGAAAATCGCTAAATCTTATGAGCAAACTAAAACTCTACTG
AATACTATAAATCATCACAATTGA


>Contig1230.1.g115(protein)
MKNEVLKQHQTHISSTQMQLQSNNNNSNQIPQSIHSQPTQSPSRGGLNLNTQIERFKQEL
SSSRYKRSLDLDKVQRGHPSVYLPIIHFYLLSYSKPVAQNIRDKGFEFHAQNDYEFVTTL
FNVLNQLFTYKPPFNIDQFFQHGMPDRKLGFVLDIISLVKSKNAILNKRSSSQKPKSVTF
KDEEGGQVEVEKQQNHLNERQSRSRGPHNGSQQQQIDMYATLNPAKGFNKNDLILAENQP
NLTNQLSHGKERQSSRSRPSNIGNFSNQVQSQNPDCSDDQNQKKEQLMRSPKYQQDSRPT
SSQYNSRSRQQQPINGNQAGNNSSQNQSHSIMMKHYSSKPPVTNNNKIPIQQTQNVSITG
SNMNGDSTCQSQQNTHRVAPVQNGKESIHSTIQKNHNNLSSPSHDQSKHRPNQNFNNNMQ
QDCLDPLNSQRNQNSNIKLRKPSIQANNYILEDSSGDQSQRSSTESHNNSKILQKIREKQ
QHISQQQKTSIPTSNSVIKNLNNEPIQAKCFTKNDQIQQIEQQKQEKQNADLALLISGLS
EQLKTMNMKFDNFQKTVDSKFDQVLHQNQSLEQKVIKIEHKFRKLKDKMIKKDSVARSGS
KRRGHSGHRHEKENNAEGNQVLASPSHHNNQKMLNQKPSSNQVYSYQVPNAISSTYQPYQ
SRHAPSVQYQNGAANGSNVINQLLVEQTVAQQNLRQPSILHQNSDKPQIQNQVPSNSTTN
NSTAQNSSQNTMRSLGHKTSIPGNSGSSYSIDQNPMHNQFSNNHDTVKNIAVHSGNNSQK
LDSQFSSLTTVKQGSTISNNNYVPNTTTTHIQPPNLIHSKYQYQQQQPSSQNSSQQQSSN
QQDEYIQKIAKSYEQTKTLLNTINHHN