Identifiers and Description

Gene Model Identifier

Contig18961.0.g33

Standard Name

CENPB1

Aliases

Contig18961_0_g33

Description

CENP-B N-terminal DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam04218 ) CENP-B N-terminal DNA-binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18961.0.g33(coding)
ATGTTACCACCTCTCAACCGCACTCAGAAGTCACAGCTAAATCTTGACTTGAATGTAGAA
TCTCCTGAATATAAAAACACTTTTATCAGGAGATAAAATCAAAAATAATTTCAAAATTTA
AATGAATAGATCAGCTAAGGTGATATTGAAGCAGGTTAATACGGATAAGAAGTTCTGACA
TAAAAGTTATAAAAGCTGAACATTCCTTCTTTTTCAAGAATGGCTCATACTACCACAAAC
ACTCCATTACTAAGAAACAAAGCCAGATCAATTCAAAGATATGAAACAATTAATTCAGAA
AATTCACTGCAATAAGAAATTGAAGAGTTGGACTAAACCCCTAGATAAATATTGAAGCAA
AAAATTAATGTTACAGCTAGTCGAAATAATGGGTTGAATTTGAAAGACCTTCAATATTAG
CTATTATCACAAAGGGGAGCTAGTAACTCAGTAAGTGATTCAATTAATACATGGAATGCT
AGTACTAGCAAGTTTATGGGCAAGCCATTAAGTAAAGCAAATCAATCTGCATCATAAGAT
AGAACAAACTTTTCAACCAGGCAACTGAATTCTTAAATTGACTTAACCTGTATAAATGAA
AAAAAGATTTTTTCAACCCCTATTTAGGACATATTAGATAAGAAAAGAATAGAAAAGGTG
TAATCTAGAATTCAGTGCAATGATAGCACAAACAGCTTCGCACCCTAAACCACTAAGAAA
TATAATTTACTTAGACCTCCCATCTATAATAAGTATCAGTCTTCACCTTAGCAAGATACG
AATTACCCTTCTTTGAAGTAGGATATGATTAAAAATTTGCAAATAAGTTAGGGTTGTGCT
CCATTATCAAGCAATGACCTAAGTCAAAAATAATACTCTTTTTAACAATCTAACCCACTA
ACTTTATCTACTCAAGAATCAATGACTGAGCTATCCAGCGCCTCAGTTAACTGCAAGAAT
TATATGAAGTCACAGTAAATTAACAAAGGTTTTTTCAGGAATTCATCTGTCAATAATTCA
ACTTCTGACATTCTCATTAATGATAAAGAGAAATAAGTCGTTAAGCAATAGTAAAGGAAA
CTTTTACTCGCTCAAATAAAGCAAACTGCTTAAGATAAAGACAACCTCATTAAAAAGTTA
AATGATCCTTAGTTTATTGATAAGCTTGCTCAACGCCTGCAAAGAATGGAGAGCGCTTAG
TTAAGTGATTCGGACTTATAAAATTATACATAATACTCAAGAGACAATGCTTGCAATTCA
AAGCAAGCAAGTGGAGACCTGCATAACTTAATTGAGATGATTCCAACTCCATGA


>Contig18961.0.g33(protein)
MLPPLNRTQKSQLNLDLNVESPEYKNTFIRRQNQKQFQNLNEQISQGDIEAGQYGQEVLT
QKLQKLNIPSFSRMAHTTTNTPLLRNKARSIQRYETINSENSLQQEIEELDQTPRQILKQ
KINVTASRNNGLNLKDLQYQLLSQRGASNSVSDSINTWNASTSKFMGKPLSKANQSASQD
RTNFSTRQLNSQIDLTCINEKKIFSTPIQDILDKKRIEKVQSRIQCNDSTNSFAPQTTKK
YNLLRPPIYNKYQSSPQQDTNYPSLKQDMIKNLQISQGCAPLSSNDLSQKQYSFQQSNPL
TLSTQESMTELSSASVNCKNYMKSQQINKGFFRNSSVNNSTSDILINDKEKQVVKQQQRK
LLLAQIKQTAQDKDNLIKKLNDPQFIDKLAQRLQRMESAQLSDSDLQNYTQYSRDNACNS
KQASGDLHNLIEMIPTP