Identifiers and Description

Gene Model Identifier

Contig1574.0.0.g59

Standard Name

CDT3

Aliases

Contig1574_0_0_g59

Description

Sperm-tail PG-rich repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1574.0.0.g59(coding)
ATGATGGATCAATCAAAACTTAATACAACACATGGTGTCTCGGGTTAATCTCAAGTGCAA
AACACAAACAATAGTCTCCTGTACAATTTTGATAAAAATTAGGTGATAAACTAAGCTGAA
TGGGATTAACAAATGTCCCCTCAACTTAATGGCGTCCAACCTGGAAACAAAGCGCATAAA
CATTCACACTCTAATATAGATTTACAAAGAATTAATGATTTGAAGGCTAAATAAATAAGA
TAATAAAGGTTACAAAACTCATCAATTGCAGGTAGTGGAGATATAGACGAGCTAATGCAG
AAATATTTGTCTACAGGAGGGGGACCTAAATCAACAACTGGGAGAAATGGAAAATTAAAT
GCAACTCTGGATTATACCCGCACACCCAATCGATCAGTTATATCTTATCTTAATGATTCA
CAATTGAATAAAGCCTCACAAAGAACATTGGCTTCTACTTTAACAAGAAACACAAATATT
CATTAAGGTTCTTCAGCTGATTTACACAAAGCCTTATCGACGTATTTGAATCAGACTGGT
CCAGGAGACTATAACCTAAAGAGCTACATCGGAAGTTAAATAATGGAGGGTAGCAAGAGA
AGTGGACCTAGTTTTAGCATCAAATAGAAAACTAAGACTACTTGGTTTCCTGAAAATGCT
GTCGCTTTCTATGGAATGCACAGTCCAGGATTAAACGTGTACTCTCCAGACCAAGACAAC
ATTTATTTCAAGAAATTGCAATTTTCCGTAGGGAAACAAGACAGATTTTTCGAGGAAAAC
CATATAAGGTAAATCAAGTAAAATGTACCAATCTCCTACACGACAAACTTGACTTCTGAT
AAGAATTAATATAAGAAAATTGGAATTGGGTATGGCTAGAAATAGCAGTATAAGGTGGAC
AAGGAAGACTAGACTACCCCAGGACCCATTTATAACAATCATGATATCAATAGCATCAGT
TATCTTAATAGGGTACCAAGCAAGTCATAATCTACGTTTGGAAATAAATACGACAAATGG
GATAGAGTGTAATATCATGGAGGTGAGTCTCACTTCTATGGAAGAGAGGGTTTAGGACCA
GGCGCCTATCACAACAATAATGACAAAATTACAAATGTTGCTATGAAATCTTCTCTCATG
ACGCCCCTGGTCCATTATCTTACGATAATGAGTTTTTGA


>Contig1574.0.0.g59(protein)
MMDQSKLNTTHGVSGQSQVQNTNNSLLYNFDKNQVINQAEWDQQMSPQLNGVQPGNKAHK
HSHSNIDLQRINDLKAKQIRQQRLQNSSIAGSGDIDELMQKYLSTGGGPKSTTGRNGKLN
ATLDYTRTPNRSVISYLNDSQLNKASQRTLASTLTRNTNIHQGSSADLHKALSTYLNQTG
PGDYNLKSYIGSQIMEGSKRSGPSFSIKQKTKTTWFPENAVAFYGMHSPGLNVYSPDQDN
IYFKKLQFSVGKQDRFFEENHIRQIKQNVPISYTTNLTSDKNQYKKIGIGYGQKQQYKVD
KEDQTTPGPIYNNHDINSISYLNRVPSKSQSTFGNKYDKWDRVQYHGGESHFYGREGLGP
GAYHNNNDKITNVAMKSSLMTPLVHYLTIMSF