Identifiers and Description

Gene Model Identifier

Contig3972.0.g94

Standard Name

CDT2

Aliases

Contig3972_0_g94

Description

DNA replication factor CDT1 like

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam08839 ) DNA replication factor CDT1 like

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002775300.00000019998969434520019hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3972.0.g94(coding)
ATGAAACAAGGACACTTATCAAGTATCTTCTAGCAAACTAAGCACCACAGCAATGCCTAG
CAGCACATGCCAGCTGTCTTAGCTAAGGATAATGAAAAATATGACACTTTACAGCAGTTC
AAGAATCTTCCTAACGGAGCTGCTAAGAATTCAAGTGGAAGTAAACTTTCCTCAGTTCAT
TCTAAGAATTCCTTGAATGCCACACCATCCACTTAGCTGTAAAACGGGTTTAGTAACTTA
AAGCAAGACTAAACATCAGAGCAAGGTCAATATGACCCCAATCTCAATCATTCATCACAG
AAATTGAAGAAAAGTAAGCAAACTCCTTAAAAACTCTCAAGTCACAAGAGTGAAGCCAGA
GATGGATCCATGTCAAATCTTAGTAATAATTAATCTACTAACAATGGTCGCCAGGGCAAG
AACAGACAGACTTTGACTTTTGACAATACTAAACCTAAGTCGCGCGAAGTTACTCCTAAA
TAAATGGCAGAGTATATGCAAAGTATCTCTGAGCTCCCAACTTCAGCTTCAACTCTAGTC
CCCAGTAAAAAGCGAGTGCAGGCTCCTTCATCTCCTGTTTCTGATGAGTATGAATAAATT
CCCAGAGTACCGGTGCATAAGGAATCAAAGAGAAGTCAAAGATCTAAAGCTAAGTAGAGC
CGCAGCAGATCATAAGCTTAAGAATAAATTTAGCCAAGAAAAGTTCAAGATGTAGAAATG
AAAAATGTTGAAAGTGAGGTTTCAAAAAAGAGAAAAATCGAAGAAATATCATCAACAATA
TAATAATAATAAGATCAGATACTTGAACTTTAAAAGGATTCTAAAAGGAAACAATTTAAT
CAAGAGGATTTGATTAAACATGGTATCATTAAGCCTTTACCTGAAAGCAGCACTACTGAC
AACGCTTAGAAGTTATCCAAGCAATAATCTTCTCAAAAGCCTTAACAAAACGTTGGCCCT
GCTGCAAAGTCTATTCTCTCTGGTTTAAGTGCAAGCACTCAAGAACTTATGAAAAAGGCT
CTTATGAATTCTAAGCAACCATAAAAGTCCACTGATGTTAGCACTCCATAAAAGCAGAGA
AATTCTGCGATGAAAACTATTTAGGACCAAGACTTGGCTTTTGAAGATATGAAACTCGAG
GATTCTCCTCCACAGATTAAACAACAATTATCTTAGCAAACAAAGGCAGTAATTAGTCAT
GTGATGAATGACCCAAGTTTGAAAATGAAGTAAACTGGCACAAATAAGAATTACTAACAA
ATGCAAGTTGACTAGTTATCAATGAGACTAAAGCATGGCTAGTTACTTTCAATTACACGG
GAACTTGTACTACCTTCTCACTATAAGCTGTTGTTAGATTTACAAGGACATTTGGACACT
TCCCTAAGCTTTATAAAAAGAAGAAAGCAGCTTGGAAAATTTGATGAGCTAAAGAAATCT
ATCGAGTCAACTCTTGGCAGAAAATTTGATATTTCTCACTTCAAATAAATGCTTACAATC
GCACCTGACTTTTACAGCTATAAATGGGAACAAATTACTCATCATGCCTAGCCTTAGCTT
GTAATTGACATCAAATAGAGTGATATATGTCAGCAGTCCCTAGACGAGAGGCATAAAATA
TTCAAGCAAAGACTTTATGACTATTGTAGAGGACACTATGATCAATTTATATAGAAGCTT
AAGCAGCAATAAAATTTGTCATCATAAGAATTCCTAGACTTCGATCCTTATAAAGAGCAA
ATGTGGCATCATTCCTTTGACCCTCACACAGTTGAACCTATTCCAATGACTGATATAGCA
CATGATATGAAAAACTATAAGCGTAGTGAGACAGTCCTAGATTTTCTCAACAAATCAAAC
ATTTAGCAATCACTTGTCTAGCAAGCTCTTGAAAAATCTGTGATAATTAATAAACAAACC
TAGTCAAGCTCTCAATAATAACCTGATGATAAAGAGTTATTATAGCTAACAGCTTTAAGT
TAGAAAACAGGTCTTTCTATTGAAACTCTGAGATTAATTAAAGCAAAGGAAGGTGCAATA
AAATAGTCTCAGAATATTATGAACAAATCTATGGTTTTACAAGATAGCCAGAAAAAGTTC
TAGACACTTTCGAAGATCAGTGAGCAAATCCGTTTATAGATGAACTTTAAGAATGTCTCA
GCTCTTTACTTAAACGATTTGGTAAAGAGTTTGAATGATAATTTGCGTGGAAACTTCTAA
TCAACCAGCGATTTATGTGCAAACATCGAAGAACTCGCTACTTTAGTGCCAGAGTGGCTG
ACTTTGAAGGACGTGAAGGGAAGGTTAGTGAAAATCAACAAAAATGTCCCCTCTCAAAGA
GTTTAAGCTTTGCTCTAAGAACGCATCCCCAAAACCTCAAACGAAGCAATAACTGACAAC
ACTGAATGA


>Contig3972.0.g94(protein)
MKQGHLSSIFQQTKHHSNAQQHMPAVLAKDNEKYDTLQQFKNLPNGAAKNSSGSKLSSVH
SKNSLNATPSTQLQNGFSNLKQDQTSEQGQYDPNLNHSSQKLKKSKQTPQKLSSHKSEAR
DGSMSNLSNNQSTNNGRQGKNRQTLTFDNTKPKSREVTPKQMAEYMQSISELPTSASTLV
PSKKRVQAPSSPVSDEYEQIPRVPVHKESKRSQRSKAKQSRSRSQAQEQIQPRKVQDVEM
KNVESEVSKKRKIEEISSTIQQQQDQILELQKDSKRKQFNQEDLIKHGIIKPLPESSTTD
NAQKLSKQQSSQKPQQNVGPAAKSILSGLSASTQELMKKALMNSKQPQKSTDVSTPQKQR
NSAMKTIQDQDLAFEDMKLEDSPPQIKQQLSQQTKAVISHVMNDPSLKMKQTGTNKNYQQ
MQVDQLSMRLKHGQLLSITRELVLPSHYKLLLDLQGHLDTSLSFIKRRKQLGKFDELKKS
IESTLGRKFDISHFKQMLTIAPDFYSYKWEQITHHAQPQLVIDIKQSDICQQSLDERHKI
FKQRLYDYCRGHYDQFIQKLKQQQNLSSQEFLDFDPYKEQMWHHSFDPHTVEPIPMTDIA
HDMKNYKRSETVLDFLNKSNIQQSLVQQALEKSVIINKQTQSSSQQQPDDKELLQLTALS
QKTGLSIETLRLIKAKEGAIKQSQNIMNKSMVLQDSQKKFQTLSKISEQIRLQMNFKNVS
ALYLNDLVKSLNDNLRGNFQSTSDLCANIEELATLVPEWLTLKDVKGRLVKINKNVPSQR
VQALLQERIPKTSNEAITDNTE