Identifiers and Description

Gene Model Identifier

Contig132.1.g130

Standard Name

CDT1

Aliases

Contig132_1_g130

Description

DNA replication factor CDT1 like

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam08839 ) DNA replication factor CDT1 like

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig132.1.g130(coding)
ATGAGCTACTTACCTCAAGCATACAGATCTAACAAAAGACTGGCACAGCTTATTAAGCAA
GAGCCTGTGAATCCTAAACCTCAATAAAAAGCTGCTCAAACCACTACATCTTTGATTCAA
ACAAGACAAACGGCAGTTAAAAATGAACCAATTCAATAGACTTAAAATACAAGGAGCAAG
AGTACTCAAAGAGATTCAAACAGCAAGTAGATATAGCTGTAAAATAATGCCTAAAAGACA
TAGCTCCCACAAAAGTAAGCTATCGTTAAACAGGAAGCTTAAAACCAAACAAGACAGCAA
AACTAAAGGTCCACCTCTAATCTATAGTCAAAACAAGTTGTTCAAGCTGCTTAATCAAGC
AATACATAAAAATAAATCAAGATTTAATAAAATGAAGTTTTGACCCAATCTAAAAAGAGA
GGATATTAAGAATCCTTGTCCCAAAAATAAATTGGCGGAAAAAATTAGCAATAAAAAAGT
GCGCCTAATTAGGTAAAAACTAAGGAAGAGCCTAAATCTCAAACTTGCCCTTCTAAACTA
CAAAGAGCCTAAAAAGACATCGATTTAGACGATTTACTCTCTTAAAAAACAGTCAGAAGA
TGCACTAAATCAAAAGCTTAGCTCATCAAAGAAGAAAAAATCGATGTTAAAGCTACTTAT
ACTTAAGTTTACTAGGGAAGAACTAAAAGACAAAAGATCTCTGACTTAAAAGTTGAAAAA
TCTAGAAGTAAATCGGCTGTCATGCAAGATCTTTCTTAAATTACTAGCAAAGTCAATACA
AGGTAATCTCTGTCAAATACTCCTAAAATTTAACCAGACTACTACACTCAAGCTTTACCT
AAGACAAATGGAAACACAAGATCTTCAAAATCAAGGAATCAAAACTTAAACACTCAGATC
AGTGAAAAGACTTCTAAAACTTCAAATAAAGCTTCCACTAAGTAAAGCAATCAAATTATT
AAAATAGAAAGCGATTATGATCTTAGTGATTTACTTAACACATCTCAGAGAACTACCAGA
ACTTCCTAAAGACATGCAAAAGAAGTATCTTTGAATTAAGGAACTTAAAGAAGAGGAAGT
AAAACTGCTACTTAAACATAGAAGTCAATTATTGAACAATAAACCTAAAAATCTTAAAGA
ACATACTCAAGACAGTAAGCTAAAATTGCTTAATAAGAAGTGAGCAGTGTCTCCTTGCAC
GACACTAGATCTACAAGGTAAACTGAGCAAGTTGCTGTATCATAAAGATCAAAGTCTCCA
GTAGCATCTACTAGTACTGCACAACACTCAAAATAAAAAGAAGCAACTTCAAGTTAAAAG
TAGAATGTATAAAAAACAAAGCCTTCATAATAAATTAAAAAGCTCGAAGTTTCACTCGTA
AGAAATATTGTAAAAATCGAAGAGCCTACCTTATAATTAGAAGAGTAAATGGATTATGAA
CCAATTACATGCTCATAGCTTATTGAAGAAATCTTACCACTCAAGAAACAAGAAAGTTAT
AAGAATGAACAGTAAGTTCAAACAAATTAAAAATCTTAAGAAAGAAACTAAGTCTCAGAA
AAGGATCTCGATGAAATGATTTTGTTTTCAGGAGTGAAATGCAACATCATATAATAACTA
GATTAAGTTAAAAAAGAGAGTTAGAGCAAGGTTGTTATTATTCAAACATAAAGCGACGAT
GAAGAAATGATGGAAGTTGATGCAATATAATATGATGCAGACTAAAGTCAAGCTGCTTTT
AAGTATACTGAAAAGTATTCAATCTAAGACATAAAGAATAATTTGGTAATCAGAGATGCT
GAATAAAAGAAAGCTTAAGACATTTTGAAACTTGAAAATGAACTAAACAAATTTGAAAGA
AAACAGCAAAAGCCCGTCCAGTAACCTATACCTTAATAAGAATTAATTAAGCAAAGACAA
TATCCAATTGGATTACAAAGAGACGGCTCATCTTCAAAGTTTACACCTCCACCCATTACA
GCTTCTAATGAAAATATCAAGAGAACTCCAACTTCAATATACAATCATGCACCAATCGCT
TACATAAAAGAAGATAAATCAACTCCAAGTTCTCTTACAAGATAGGTTTAGCAGTAATAA
ATTAACCAACTGAGGAGAACAAACTTGATCGAAGAGGAAAAGAAATAAAATTAATCTGAA
ATATAAAGTACCGTAAGTTAAGTCGATTCTCATAGGACTCCTCAAAGAGCTCTTCCAGAT
TAAGTGAAATTGTATATCACTTAAAATCTTATCACACCAGAAACTTTAGATTAGGTTCGC
CGAGCTTTCTCTAATAAAGCCACTCCAAGTCATTCTTATGTCTTGAATCATTCTTCAAGT
GCTAACGCTCCCATAAGATACTCTTCATCGAATAAGCGTATAAATTCTGATAAGCCCACT
CCATGTCTGGACAGAAAACTTAATGAGTTAAACAATTCTGCAAATATTCATGGTGGTGTC
TTGCTAGGCAGTAACACTCAGCTGAACTTTATCAATTTAAACTAAGCATCAAATCAAAAT
GCAGTAAGCGAGTATTCTAATATTGGTAATAACGGAACTTTGTCAAGATATGGACAGGGT
CCACAAGACAATAGCATGAATAATCTCAATTTTTCACCAAGACAAGGAAACCACAGCTTC
TCACTTTCTAATATTCAAAGTGAAGCAATCACTCCATATAAGGAAAGATATGATAGAGCG
AATAAAGAAGAAGAGGAAAAGTAGTAAAAGATTAGTAAGTAGCTGAAGATTGAAGAAGTA
AAACAAGATTAAATAAAGAATACATTAAATCCTGAAATTTTGACGCAAAAAATCCTTGAG
CATAGCAAGAAAGAACAAATTATTAGGAAATAAGCTGTCTAAAATATCAAATAAGAGTAA
GATACTGAAATGACTGACGAAACACAAAACAAATAAAAATCATTAGAATAAGAAGCACAA
CTTAAAGCTAAACAATTACTTAACACAATTTCTATGTCTGAGAAATATTCAGAGCTTTTG
ACTATGGATACAAAGAAAATTTAGTTAGCACTTCCAGCTCATTACAAATCTTTAATGAGT
CTATTTTGTGCTCTCGACTAAACAATTAACTTTTTAAGATCAAGAAAATTAGCCTTAACC
TTCACTAATATCTAGAAGGCTGTACAGTAAACTATGAGAAAGTAATTTAGTTAAGGAAAT
TTCGCTTAGATAATGTTTGTAGCACCATTCATGTATAATCATAAATGGGAGGCAAGAGCA
AAAGGATTTGAAATTATTGTTGAAATCCCTAAAAATATCAAACTGCTTCTAAGTAAATAA
GAACGAATCCCTTCTGAAGAAGCATTTGAAGATATGATGGTCTCAGACCTTCTTGAAAAG
AGAAAGTAATACTTTTAGGATAGACTTCTTAACATCACATATCAGCATTACTTAAAATCC
AAAGAGCAAAACAAAGACATTCTAAAATACCATGATCTAATTTAATTCATTGATCCCTTG
ACTTAAAACTAATGGCCAGTCTTCTTTGATCTTCATGAAGTTCCAGAGATTCCAAAATAT
TAATTGAAAGAACAGCCAAAATCTGTAAAATCCCAAACGATATCAGAGTTCATTAACATA
ACAAACGTTAACAAACAAGCCAAACAGATCCCCGACTCCTTCATTACAGCTTAGGAGAAA
GCTTATGACTAGAAAGCAACTCCACTCTTGACTGTAACAACTGAAAAAGGCAAAGAATCA
CCCTTGGTATAACTCTTAACCTAAGACGATGGCTAGTAATCAGTGAGCACTGCAGTAGCT
TCAAATACGACAAATTAATCTGGTTATTCTACTTCAAGTCGATTATTAGAAGCACACATG
TACCTCACTTAAGATTTAATCTCTAAAATCAAGTAAAAGCAGAATAGAATTGAATATAAC
AAGTTTTTGAATAAGGAGCATATGGAAAGACAGGACGATGAGAAATACGCTGAAAATTTC
ACTAAAATAATAAAAGCTATAAGTATGTAATTCGTTATAAGACAGACAAATACCATGCCC
TTCAAGGAACTTTTAAGTGTACTTGATGATAAACTTCGTGGCCAATTCAATTCTAAAGAA
CTGTTGACAGACTAGATTAATCAGTTGACTTAGATATTGCCAGAGTGGATATAAATCATT
TCAAGTCCTATGGGAGGTTAGCACTTAAAAATGAAAAACAGAAAATTCTAAGTCCCTGAA
CTCAGTGCAAGAGTTGAAGTTTACTTAAAATCAAATCAGAAATCACTAAATTTAAGTTCC
ACTCTAATTGCAAACAATAACAGTATGACTCAATAAAACTGA


>Contig132.1.g130(protein)
MSYLPQAYRSNKRLAQLIKQEPVNPKPQQKAAQTTTSLIQTRQTAVKNEPIQQTQNTRSK
STQRDSNSKQIQLQNNAQKTQLPQKQAIVKQEAQNQTRQQNQRSTSNLQSKQVVQAAQSS
NTQKQIKIQQNEVLTQSKKRGYQESLSQKQIGGKNQQQKSAPNQVKTKEEPKSQTCPSKL
QRAQKDIDLDDLLSQKTVRRCTKSKAQLIKEEKIDVKATYTQVYQGRTKRQKISDLKVEK
SRSKSAVMQDLSQITSKVNTRQSLSNTPKIQPDYYTQALPKTNGNTRSSKSRNQNLNTQI
SEKTSKTSNKASTKQSNQIIKIESDYDLSDLLNTSQRTTRTSQRHAKEVSLNQGTQRRGS
KTATQTQKSIIEQQTQKSQRTYSRQQAKIAQQEVSSVSLHDTRSTRQTEQVAVSQRSKSP
VASTSTAQHSKQKEATSSQKQNVQKTKPSQQIKKLEVSLVRNIVKIEEPTLQLEEQMDYE
PITCSQLIEEILPLKKQESYKNEQQVQTNQKSQERNQVSEKDLDEMILFSGVKCNIIQQL
DQVKKESQSKVVIIQTQSDDEEMMEVDAIQYDADQSQAAFKYTEKYSIQDIKNNLVIRDA
EQKKAQDILKLENELNKFERKQQKPVQQPIPQQELIKQRQYPIGLQRDGSSSKFTPPPIT
ASNENIKRTPTSIYNHAPIAYIKEDKSTPSSLTRQVQQQQINQLRRTNLIEEEKKQNQSE
IQSTVSQVDSHRTPQRALPDQVKLYITQNLITPETLDQVRRAFSNKATPSHSYVLNHSSS
ANAPIRYSSSNKRINSDKPTPCLDRKLNELNNSANIHGGVLLGSNTQLNFINLNQASNQN
AVSEYSNIGNNGTLSRYGQGPQDNSMNNLNFSPRQGNHSFSLSNIQSEAITPYKERYDRA
NKEEEEKQQKISKQLKIEEVKQDQIKNTLNPEILTQKILEHSKKEQIIRKQAVQNIKQEQ
DTEMTDETQNKQKSLEQEAQLKAKQLLNTISMSEKYSELLTMDTKKIQLALPAHYKSLMS
LFCALDQTINFLRSRKLALTFTNIQKAVQQTMRKQFSQGNFAQIMFVAPFMYNHKWEARA
KGFEIIVEIPKNIKLLLSKQERIPSEEAFEDMMVSDLLEKRKQYFQDRLLNITYQHYLKS
KEQNKDILKYHDLIQFIDPLTQNQWPVFFDLHEVPEIPKYQLKEQPKSVKSQTISEFINI
TNVNKQAKQIPDSFITAQEKAYDQKATPLLTVTTEKGKESPLVQLLTQDDGQQSVSTAVA
SNTTNQSGYSTSSRLLEAHMYLTQDLISKIKQKQNRIEYNKFLNKEHMERQDDEKYAENF
TKIIKAISMQFVIRQTNTMPFKELLSVLDDKLRGQFNSKELLTDQINQLTQILPEWIQII
SSPMGGQHLKMKNRKFQVPELSARVEVYLKSNQKSLNLSSTLIANNNSMTQQN