Identifiers and Description

Gene Model Identifier

Contig1744.0.g48

Standard Name

CDK1j

Aliases

Contig1744_0_g48

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001337591.0003180480544985e-86cdk10/11
SGDYKL139W4.997593565024277e-70CTK1 SGDID:S000001622, Chr XI
from 182958-184544, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1744.0.g48(coding)
ATGGCGCTTGCAGAACCAATACAAAACTAGAAAAGCCCCAGCATATTAAATGGTGGCAAT
TCTATGAGATATGATACTATAAGTATTGCTGGAGGGAATTAACAATTCTTAGATGCTGAT
ATTATTGAATTTCCAAAGGAACTCTTTGGCCAGGAATAGAAGAAACTCGGCAATTATGAC
AAAATAGAAAAGATTGGAGAGGGAACATTTGGTTAAGTATACAAAGGAGAATATGTAAAT
CCAGATACAGGAGAAAAGAAATTGGTAGCTCTCAAGAAACTCAATATGATAAATGAAAAA
GATGGGTTTCCAATTACAGCTTTGAGAGAAATTAAGTATTTGAAGCAATTAAGTCATGAG
AATGTTGTCAAACTTGAGGATATAATAGCTTCTAGACCAAGAAGAAGAAATAAGTAAAGA
GGGAGCTTCTATTTAGTATTCGAGTATCTTAAATACGATTTACAAGGTCTTATTGACAAA
AAGATTACTTTTGAGCTTTCTTAATTGAAATGCCTAATGATTTAAATGCTCCATGGATTA
ATTTATTTGCATCAGTAGAAAGTAATGCATCGTGACATCAAAGGTGCAAATATCCTGATA
TCATCAAATGGAGTAGCAAAAATTGGAGATTTTGGATTAGCAAGAATATATTACCCTGGG
AATAAACAGGCTTAATACACTAATAGAGTAGTGACTTTATGGTATAGAGCTCCTGAGCTA
CTACTAGGTGCCAGAAATTATTCGGATACTCTAGATACTTGGTCTATGGGTTGCGTATTT
GCTGAGATGGTACTACAACACGTACTCTTTCCTGGAGATAAGGAGGAGAAATAAGTTGAG
TTGATATACGATAAATGTGGAAGTGTGGACGAAGAAAACTGGCCTGGGGTAACAGAGATG
AAAGCATTCAAAGAGTTTGGTCCTAAGAAAAAGTAGCCAAGAAAAATTAAGGAATATCTA
ATGGCATAGAGTAAGGGAAAAATAAATGAAAGCTTAGCAGACTTGATTGATCACATGTTA
ACTATGGATCCAAGGAAGAGATATACAGCAACTTAAGCATTAAATCATCATTTCTTTACA
GAAGAACCTCTTCCTCTACCAGATGAAGACTATCACGAATTCATTGTGAAAAGTGAAAAG
AAGCAAAAGGTAAACTTCAAAAAGAAATTTGCTTTCTATAAATAGCAATACGACATTAAC
GATCCACTTACAAATAACATTTGGAAACCATCCATGGAAAATATAAACACTAAGAAGTTT
GTGAATTTGCTCTAACCAGCACTCATTCCTGCTGAAGAATAATAAAAGCTTTAGGAGCTA
TAGCAATAATAACAGCAATAATTGAAATCAAATGAACACAATCTTGTGACTGGAAACTTC
TACAGAGGTGGCTATTAAAATCGAGGCTATTAGAATAGGTATAGCCACGGAGAAGACTAT
CATAATAGATACAATAACAATAACTTTTATCATAATAATAAGTACCAAGACTTCCCTAAG
AAAGACTATAGATTTCATTAAGGTACAACTTTAAATTAGGGAATTGTTAAAGACCCCTAG
GAGAGATTTGAATTAGAGAAATAAAAATAAAATTCTGTATTGAATAAAGATTTGAAGATT
CCAGAAGAATAAAGTGAAATTAAAGTTTAATTAGAAGATCTATAAGTTACAGAGAAAAAA
GAGGAATCTCAATACTACAATCGTCATTACAGGCCAGAGTATGATATAAGAAATAAAAGA
GGAGGGATTGAAGGAGCTTCATTTAATGAGTCTGAAAGAGGGAGGTTCACGACAAGAGGT
TATGGGAGAGGCTATCATAACTACAAAGACAGAGATAGATAATTCTAGAATGATAGATAC
CGCAATTATAGAGACAAAGATTAGAAAGTTGAGTCAAGGGAATCAAATAACGACGCTAGA
GTTCTATCTGGCTCAAGAGACAGAAAAGATTTTGATGCCAAATAGAGAGACAGTTAGCAT
CCATATTTTTAACAAAAAAGAGATAGGAACTTTGATAGAGATAGAATTTCATATAGAAAT
GACAAAAAACAAAGTAGAAGTAGATCTAGATCATATGAGAAAAGAGGCAAAAAGTCTTTC
TCCCGTTCTTCCTCTTCGTCTCATTATTCTTCTAAAAGTAGAGTTTCTTAAGAAAAACTT
CATACAAGAAAAGTATCTTCAAATTTTAGCAAATAGGAAAAAAGTGCTGAGAAACAAGAG
AGATCCTAGGAAAAGTAATAAGAACAACTCCCTAATATTAGAATAGATAACAAAAATGAG
AATTTAAGAAAGGTTGAAGTTCCTAGTGCAAAATTTGATGATAAATAGCAATTGGATAGC
AAGGCAAGTGCTTCTAAAGATTAAAGATAGAATATTGTATAGTATAGGACAGATGATAAG
TCTAATATTGAACACAAAAGAAGCGGTTTTCATGAATACATGGAGAGAAATAGTCAATAA
GCTAGAGAAGAAAAAGAAAGATAAAGTATTAAGGCACCTATAGCATACAGCGAGAGAAGA
GATTTTGATGTAGACAGATAAAATCCAAGTAAAATCAGAGACAGCAGGCAAACATTCTAA
GAACCGCCAGCTTTAGCAACTGAAAAAACTTATCAAATTCCAAAAGCCTCATTGAAAGAC
CTTGATCTGAGTGTGAATAGTTATGACACTAATCAAGGGCAAAGAGAAAAACTTTAAGAT
CAAAGACTTAGTCGTAATGAGACTGATCTAAAATTTAGAAAAAACTCAAGAGAGTATGAC
TCAAATAGAGATAAGTCTAGAAGCATTGATAAAAGTAGACAAGATCCATACTAGAAAGTT
GAATAAGGGAAGAGAAAAGAGAGCTTGAAACTATAAGCAACTCTTAAGAGCAAAGAACTG
CACCAAGATGAGAGAAGAAGAGATTTCGAAAAAGATGATAGACAATCTAGGGAAGAAAGA
AGACCTGGTGAAAGAAGGGACTTTAAACAGGCTCCAGACTACTATAAAGACTAAAGACTC
TAATAAACTCAAGATATCAAGGAAAAGCCAAGAGAAAGCATCTAAGACAACGATTATAAT
CAAAGGTCAAGTTACTTTAGATAAGATAATGATAGAAGACCCTACGGAAGCACTTAAAAA
TCTGATTTCAACAAGAATTAAAGGTTTAATCAATAATCCTATCCTAGGCAGCCGTATGAT
TCTTCTAGACCAGATAACTAAAGAGACTCTTAATTTCATGATACCAAAAAACAATCTGAT
AAATATTATCTTGATAGAAGACCTCCAGTTACTCAAAACAACTAGAATTACAGAGACGAG
AAGTTTCAACCAAGGGACAGATAATCTGGATTTGAACCAAGTCACAGATTTAACAATTAA
AACCAATAAAATCCTTCTTATTAATAATCGGGAAAGCCTTACTAAAGTAATAGAAGTAGA
TCGAGAAGTTATGAAGTCCGGGATAAACCATTATAGTTCTAAGGAGCGAGAAATTATAAC
CCCAATAATAGCAATTATTAAAGATAACCCAGAGAGGATTTTCAAAATAGACAGTATTAG
AATTATAGAAAGAATAGCAGAGAAGGCTTTGAAGAGGGTGAAATTAAAAAATGA


>Contig1744.0.g48(protein)
MALAEPIQNQKSPSILNGGNSMRYDTISIAGGNQQFLDADIIEFPKELFGQEQKKLGNYD
KIEKIGEGTFGQVYKGEYVNPDTGEKKLVALKKLNMINEKDGFPITALREIKYLKQLSHE
NVVKLEDIIASRPRRRNKQRGSFYLVFEYLKYDLQGLIDKKITFELSQLKCLMIQMLHGL
IYLHQQKVMHRDIKGANILISSNGVAKIGDFGLARIYYPGNKQAQYTNRVVTLWYRAPEL
LLGARNYSDTLDTWSMGCVFAEMVLQHVLFPGDKEEKQVELIYDKCGSVDEENWPGVTEM
KAFKEFGPKKKQPRKIKEYLMAQSKGKINESLADLIDHMLTMDPRKRYTATQALNHHFFT
EEPLPLPDEDYHEFIVKSEKKQKVNFKKKFAFYKQQYDINDPLTNNIWKPSMENINTKKF
VNLLQPALIPAEEQQKLQELQQQQQQQLKSNEHNLVTGNFYRGGYQNRGYQNRYSHGEDY
HNRYNNNNFYHNNKYQDFPKKDYRFHQGTTLNQGIVKDPQERFELEKQKQNSVLNKDLKI
PEEQSEIKVQLEDLQVTEKKEESQYYNRHYRPEYDIRNKRGGIEGASFNESERGRFTTRG
YGRGYHNYKDRDRQFQNDRYRNYRDKDQKVESRESNNDARVLSGSRDRKDFDAKQRDSQH
PYFQQKRDRNFDRDRISYRNDKKQSRSRSRSYEKRGKKSFSRSSSSSHYSSKSRVSQEKL
HTRKVSSNFSKQEKSAEKQERSQEKQQEQLPNIRIDNKNENLRKVEVPSAKFDDKQQLDS
KASASKDQRQNIVQYRTDDKSNIEHKRSGFHEYMERNSQQAREEKERQSIKAPIAYSERR
DFDVDRQNPSKIRDSRQTFQEPPALATEKTYQIPKASLKDLDLSVNSYDTNQGQREKLQD
QRLSRNETDLKFRKNSREYDSNRDKSRSIDKSRQDPYQKVEQGKRKESLKLQATLKSKEL
HQDERRRDFEKDDRQSREERRPGERRDFKQAPDYYKDQRLQQTQDIKEKPRESIQDNDYN
QRSSYFRQDNDRRPYGSTQKSDFNKNQRFNQQSYPRQPYDSSRPDNQRDSQFHDTKKQSD
KYYLDRRPPVTQNNQNYRDEKFQPRDRQSGFEPSHRFNNQNQQNPSYQQSGKPYQSNRSR
SRSYEVRDKPLQFQGARNYNPNNSNYQRQPREDFQNRQYQNYRKNSREGFEEGEIKK