Identifiers and Description

Gene Model Identifier

Contig17113.0.g22

Standard Name

CDK1f

Aliases

Contig17113_0_g22

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000116709.998285701479858e-93Protein kinase domain containi
ng protein
SGDYPR161C9.99711830094262e-74SGV1 SGDID:S000006365, Chr XVI
from 866422-864449, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17113.0.g22(coding)
ATGGGCACACAATTAAACCAACCAAATGATGTTGCTAATCAGTAATTAGGAAATGGGAAT
TCTCAAAACAACCCTGCTTCACTTAATGGAGCAAGTAATGGCTTGCATCACTAAAATTAA
AATCATTAGCAATAAGTGCAATAAATTATTGCTCAGCCGCATCAATAAAGACCACCAGTT
GAGTTACAGCCACCCACTATTGCAGAGCTCCCTAAATCAACTATCAAAGTGCAGAGAATC
AGTAAAGCTCAAATGTAACTCAGAGATGCTGATGTTTTCAAAGAAAGGTCAGTCATAGGC
CAGGGTACTTTTGGGCAAGTGTACAAAGCTAAATGCTAAAATACTGGTGAGACATATGCT
CTCAAGAGAATAAAGATGGATCAAGAAAAAGAAGGGTTTCCAATCACTGCTATGAGAGAG
ATAAAGATTTTGAAGAGACTTAATCATCCAAACATAGTTAAACTCAACGAAGTTGTGACT
TCAAAACCAAGCAGAGAAAATAAGCATAGAGGATCTGTGTACTTAGTGTTTGAGTTTGTA
GAGCATGATTTTCATGGAATCACAGACAGGAACATAAGATTTGAGTTGTCCCATTTGAAG
TGCATAATGCTCCAGATGTTAGAAGGTGTAGCTTTTATGCATGATAACTGCATCTTGCAC
AGAGACATTAAAGGAGGAAATATTTTATTAAATAAGGAGGGAGTTCTTAAGATTGCTGAC
TTTGGACTAGCAAGAATCTTCTATCCTGGAAATCGTGAAGCTCAATATACCACGAGAGTT
GTTACTTTATGGTATAGAGCACCAGAGTTGCTGCTAGGATAGCGTAATTACACAGCTGCT
ATTGATATGTGGTCTGTTGGGTGTTTCTTTGCTGAGTTGATGACTGGAAAGCCCTTGCTA
CCAGGAAGAGACGAGGGACAGTAAATTCAGCTGATAATCGATAAGTGTGGAGCAATAAAT
GATAAAGTTTGGGAAGGTGTGCAAAACCTTCATCTCTATCATTAACTATTAGGCCCTTTG
AGAACTAGTAACCAAGGTAGCAAGTTAAGGTAGTACTTCAGAGATCATTAACTAGGAGGA
GAGCCTTAATTCCTAGACATGATCGAGAAACTTTTGAGCTTGGATCCATCAAAGAGAATG
ACTGCAAGATAAGCACTTAAACATCCTTTCTTCTAGCAACTGCCATTGCCCTGTAAACCT
AGTGAACTTCCAAAGATTGAAGGAGAGGCTCATGAAATGATTGTCTCTTAAGAGAAGAAA
AAGTAGCAGTAAATGAAGCAATAGCAGCATCAATCTCATTAATTCAATTAGAATGCAAAT
CAATCAAATTAATATGGTGATAGATAGCACAATTATAACTACTAACAGCCTTCACATAAC
AAGAATGAGTTTTACTAAGGCAAGAATCGAGGTGGTCAACAATTCTAATAAAACACGATA
GATTAAATTCCAAATAATCGCGATTAAGATCAACAAAATCACCAACCTAATCAAAATACT
GTTAACTCCCCTATCTATGAAGATAAAGCCTAGCTAATTTAGAGACAAGGATCAATGCTT
GGAAAGAGGCAGCAAAGAGACGATGAAAATGGAATTACCAACTCAACTGATTAAAATTAA
TAATAACAGCTATAAAAGCATTAGTAGGAGCAGGGAGACTCAATCAAGAGACCTAATTAC
AATTAAAATTGA


>Contig17113.0.g22(protein)
MGTQLNQPNDVANQQLGNGNSQNNPASLNGASNGLHHQNQNHQQQVQQIIAQPHQQRPPV
ELQPPTIAELPKSTIKVQRISKAQMQLRDADVFKERSVIGQGTFGQVYKAKCQNTGETYA
LKRIKMDQEKEGFPITAMREIKILKRLNHPNIVKLNEVVTSKPSRENKHRGSVYLVFEFV
EHDFHGITDRNIRFELSHLKCIMLQMLEGVAFMHDNCILHRDIKGGNILLNKEGVLKIAD
FGLARIFYPGNREAQYTTRVVTLWYRAPELLLGQRNYTAAIDMWSVGCFFAELMTGKPLL
PGRDEGQQIQLIIDKCGAINDKVWEGVQNLHLYHQLLGPLRTSNQGSKLRQYFRDHQLGG
EPQFLDMIEKLLSLDPSKRMTARQALKHPFFQQLPLPCKPSELPKIEGEAHEMIVSQEKK
KQQQMKQQQHQSHQFNQNANQSNQYGDRQHNYNYQQPSHNKNEFYQGKNRGGQQFQQNTI
DQIPNNRDQDQQNHQPNQNTVNSPIYEDKAQLIQRQGSMLGKRQQRDDENGITNSTDQNQ
QQQLQKHQQEQGDSIKRPNYNQN