Identifiers and Description

Gene Model Identifier

Contig3758.0.2.g53

Standard Name

CDC73

Aliases

Contig3758_0_2_g53

Description

RNA pol II accessory factor, Cdc73 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

  • negative regulation of transcription, DNA-templated (IEA) | GO:0045892

Domains

  • ( pfam05179 ) RNA pol II accessory factor, Cdc73 family
  • ( pfam04316 ) Anti-sigma-28 factor, FlgM

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007604901.9999391735788327e-19hypothetical protein
SGDYLR418C0.000000005997038937208364CDC73 SGDID:S000004410, Chr XI
I from 958095-956914, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3758.0.2.g53(coding)
ATGAGAGATGCCTAAGGCCAAGGATTTCAAGTGATTCAAATGAATGATCGTCAAGAAATT
TAAACTTATTTCAGTGGCGCTTCAAACTCATCCAATCAGATAGACGAGCAGTACAGACCT
TAAACTCTCATTAAGAAATCGCATTTGAGAAGCAGTAGAGCAGTTCCCGTTGCTAACTTG
CAAGGGCAAGCAGGCCAAGTTCTTATGAGAAAGCGTGATGCCAAAGCAGAGGAGAAGATT
TAACAAAAGATGAAAGTGTTTGAGCATTTACTTCAGAATGAGAGAAAGATCTCAAGCAGA
GCTACAGCTATTCAATCACAGAATAGAAGCTTTTTGAAAGTCTTGCAACTAGCTTATTAG
ATGACTGGCTAAGAGAAGAAAGTTCAGGAAGTGAAAGAGAGAATAGAGAAGAGACAAGGA
AAATGCATAATGGTGAATCTTGATGTTGGGTGTCTACAGGATAAAACCAAAAGAAAGTAA
TCACTACTTGAAGAAATCATTAAGGGGAACAAATAAGATCGTAATTTCTCCCGTGGTGCT
AGATAGAAGCCAATAATCATAGTGCCAGCATCCCTCTACCCTGGAAACATTTCGATTTCC
AATGCAGTTTAATTCCTTCAAGAAGGGCAGTACTAAGCCAATCCAAACCAACAATAGCTT
AGCCAGGATAATAACAACTTGAAAACTGAGGTCACTCACACAATCAACGGAGAAAAGGTT
GTATTTGAGATTCATGACAACGTGCAGTCATTCACTGATGAAAAGTGGAAAAGAGTCGTT
GCAGTGTTTGTTAATGGCTTTGACTGGCAGTTCAAGGATTGGCCAATCTAGAATCAATCT
AAGATGGTAGATCTACTAGACAACTCAACCAGAGTTTGCCAAGAAATGGTCTATTAAAAT
CCTCCAAATTCACAGAAACAAGAGGCATCAAGATATCAGCATATACAATGA


>Contig3758.0.2.g53(protein)
MRDAQGQGFQVIQMNDRQEIQTYFSGASNSSNQIDEQYRPQTLIKKSHLRSSRAVPVANL
QGQAGQVLMRKRDAKAEEKIQQKMKVFEHLLQNERKISSRATAIQSQNRSFLKVLQLAYQ
MTGQEKKVQEVKERIEKRQGKCIMVNLDVGCLQDKTKRKQSLLEEIIKGNKQDRNFSRGA
RQKPIIIVPASLYPGNISISNAVQFLQEGQYQANPNQQQLSQDNNNLKTEVTHTINGEKV
VFEIHDNVQSFTDEKWKRVVAVFVNGFDWQFKDWPIQNQSKMVDLLDNSTRVCQEMVYQN
PPNSQKQEASRYQHIQ