Identifiers and Description

Gene Model Identifier

Contig18195.0.g14

Standard Name

CDC7

Aliases

Contig18195_0_g14

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007291701.9997255150861791e-53Protein kinase domain containi
ng protein
SGDYDL017W9.995528898049344e-31CDC7 SGDID:S000002175, Chr IV
from 424209-425732, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18195.0.g14(coding)
ATGCTAAGCAAACAAAAACCATTGCCATAACAGGTAGACTTGAACAAAAATAAGAAGCCA
TAGGAGCAATAGACAAGAATATGCACTTTCGAAGAACTCAGAGGAGAGTTTGAGATCAAG
CGAGAAATTGGAAGAGGGTCATATGGAGTATGTTTTAAAGGCATAAAACGAGATTAAAAC
GATGTGGACGAAAATGGTAAGCGCAGATAATACGCAGTAAAAAGAATCTTTCCAACAATT
AATGCTGCTTTTATCTTGATTGAAATGCTCATTCTTAAGTTGTTGAATGGTGAGAGCAAC
GTAACAGATCTGATTTGTGGTTACAGACTAGAGGGTCAAGTGTCTTTAGTTTTTAAATAT
CAAAAGAGCAAGCCATTCCTGACTTACTTGACTACTTTTAACTTGGATGATATTCGCAAG
TACATGTTGGCTTTACTCAAGGCTGTTAATCATTGCTCAAATTATGGAGTCATTCATAGA
GACATCAAGCCTTCGAACTTCTTATATGATCCTGACACTCACACTGGATTACTCATTGAT
TTTGGACTATCTGAAATTTAAGTGGACTAATAAGGAAAGCCTATGAAGCTTGCTGACAAT
GAGACAGTCAAGAAAATTGCTGAGTTGTAAAAGACTTTGAAGATCAAGAATAGAACAGGT
ACCAAGGGATACATGCCACCAGAAGCACTACTCAACTATCATGCTCAAACAAGTGCAGTT
GATATCTGGGCATGCGGAGTTATATTCTTAAGTTTCCTAGCTCAGAGACACCCAATCTTC
TCTTTGAATAACAGCTCTAAGATCAAGAACTTTACTATCTCAAACTTAATCCCATTTGTG
TGTTTATTTGGGCAAAATAACATCAAAGAAATTGCTTTCAAATTGGGCTATGGATGTTTG
ATTCCAGAGGAGATGCAGAAGGAAAGATTAGACTGGAGAGACATTTGCAAGATCCATGAC
GATGACGCTTTCGACCTCTTAAATAGAATGCTGGAGCTAGATCACTCAAAGAGAATAAAA
CCTGAAGATACTCTCAAGCATCCTTTCTTCACTAAAAATACAATGAGAAATCCCTAAAGA
ACTGCAGATGACATAGAAATGAAAGAATCATTCATGCAATAAAATCCATAAACTCATCCT
ACTTGTGACTCTGATAAACCTAATTATCAATTGAATTCAAAATAGAGTAATTAAAGAAAC
CTTTGA


>Contig18195.0.g14(protein)
MLSKQKPLPQQVDLNKNKKPQEQQTRICTFEELRGEFEIKREIGRGSYGVCFKGIKRDQN
DVDENGKRRQYAVKRIFPTINAAFILIEMLILKLLNGESNVTDLICGYRLEGQVSLVFKY
QKSKPFLTYLTTFNLDDIRKYMLALLKAVNHCSNYGVIHRDIKPSNFLYDPDTHTGLLID
FGLSEIQVDQQGKPMKLADNETVKKIAELQKTLKIKNRTGTKGYMPPEALLNYHAQTSAV
DIWACGVIFLSFLAQRHPIFSLNNSSKIKNFTISNLIPFVCLFGQNNIKEIAFKLGYGCL
IPEEMQKERLDWRDICKIHDDDAFDLLNRMLELDHSKRIKPEDTLKHPFFTKNTMRNPQR
TADDIEMKESFMQQNPQTHPTCDSDKPNYQLNSKQSNQRNL