Identifiers and Description

Gene Model Identifier

Contig21598.0.g16

Standard Name

CDC5

Aliases

Contig21598_0_g16

Description

pre-mRNA splicing factor component

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam11831 ) pre-mRNA splicing factor component
  • ( pfam00249 ) Myb-like DNA-binding domain
  • ( pfam13921 ) Myb-like DNA-binding domain
  • ( pfam12815 ) Spt5 C-terminal nonapeptide repeat binding Spt4

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010357701.0003814179949055e-122Myb-like DNA-binding domain co
ntaining protein
SGDYMR213W1.9999167998962255e-60CEF1 SGDID:S000004826, Chr XII
I from 693381-695153, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21598.0.g16(coding)
ATGAGATACATGGTGAAAGGTGGCATCTGGAAGAACACTGAGGATGAAATCCTCAAGGCA
GCTGTCATGAAGTATGGCCTCACTCAATGGAGTAGAATTTCATCATTGTTGGTAAGAAAA
TCAGCCAAGGAATGCAAAGCTAGATGGTATGAATGGCTTGACCCTGGCATTAAGAAAACT
GAATGGACTAGAGAGGAAGAAGAGAAATTACTGTACTTAGCCAAGATCTTCCCGACGTAA
TGGAGAACTATTGCACCTATAATTGGTAGAACTCCAGCATAATGCATTGAGCATTACGAG
AAGCTCCTTGATGCAGCTTAAGGGAAATCAGGAGAAGAATTCGATGAAAGCGACCCTCGC
AGATTACGCCCAGGTGAAATCGATCCAAATCCTGAGACAAAGCCTTGTAAGCCAGATCCA
GTAGACATGGATGAAGATGAAAAGGAAATGCTTCAGGAATGCAGAGCACGCCTTGCAAAC
ACCAAGGGTAAGAAAGCCAAGAGAAAGGCCAGAGAAAAGCAGCTTGAAGAAGCCAGACGC
ATGGCATCAACTTAAAAGCAGAGAGAACTTAAAGCTGCAGGAATTGATGTGAGAAGACCT
ACAAAAATCAGGGGAGTCAACTACAACATAGAGATTCCTTTCGAAAAGAAGGTACCTATA
GGCAGATTTGATACCAGTGAGGAAGCTCTTCAAATTGATTAACTTAAGCAAAACATTGCT
CTACAGTAGATTGAAATCAAACGCAGAGATGAAGATGAGAAAAAGAGAAGAGCATTAGAT
GCTAAGAAATTAAAGAAACTCAAGCAGAAGAACTTACCAAAAGCTCTTGAGTTGATAAAC
AAAAACGATAATGCTGCTGCTATGATTGGCATCAACACAAAGCTTTCTCTACCTGCACCA
TAGATTAATGACGATGAACTCGATATTATTAAGAAATATGCAGCTGGTAATTTAGAAACG
ATGCCTGGAATGGGACAAGCAGATTCTACAGCAACTAGAGCTTTGATGGGAAATTACTCT
TAAAGAGACATTCTTTAAACTCCAGCAGCATCTCAAATGGGAGGCAAAACACCTCTTATG
AGTTAAAGAATCATGCAGGAAGCCTAAAATGCTCTTTATTACAAAAATTCACAAACTCCT
CTGATTGGTGGGGAAACTCCTTAACTTAATAATACAGGTCTTAGAGCTGGACAAGACTCT
ATTCATTAAGGCTAAACTCCTTCTTTGCTAGCCAAGAGATAAAGTACTGGGATGATTGGT
ATGTAAGACTAAGATGGCTTCATTATGCCAGCTCCAAAGAGACATAAGCAAACTGGTATA
ATTTAGCCATAGAGGCTCCAGACTCCTCTTAGAGACGAATTTAAGTTAAATCAATCTGAG
GATACTTTAATGGATAATCAGTGGGAAAGGTCTTCCATGATTAGTGGCATGACTTAAATC
GACACTTCTACATAACAAAGAGGTGAATTTAACATCACAGCTTAACTCGCTAATCTTTCC
AAACCCAGAAATGAATTTGAAATATCAGCAGAAAGAATTATTGAACTAGAGGAGTAAATA
GCTAGATAGGAACAGATGATTTGGGAAAATGAAAACGAAAAATAGAAGGTTGAAGACCTT
GAGGATTAGAAAGCCAGACTTAAAATTGAGAAAGCTAAACTTGAAGAGCTTGAGAGACGC
AAGTAATCCACAGTTATCAAGTAAAACCTGCCCAGACCAAACATTATCAACTAGAAATTC
TTCAAATAAATCTAAGAGAATCAAGATGTGGTTTAGAAAATGATCTTTGAAGAAATGTAG
GCAATGCTGATCAATGATAATCACAAGCACCCAGTCAAAGGAATGAAGGAGATAAAATAG
GCAAAGTACTTCTAAGAAATTTCACCAGAGTATATGGAATATGCCAGATAACTTATTTAG
GAGGAAGCTCAAAATGGATTGGAGTTATATCCCATGTTCAATTTCAACAAAGTATGGGAG
AACCTACATCAAGAGAAAGCTATGTTTTTCCCTGGCACTAAAGATTTTGACTATCTTTAA
AATCGCTCAAAGGCTGAGTAAATTGAAGCAGTTCGTTTTGAATTTGAGACAGCCACTAGA
CATCTTGAGAAAGAAATTTCTCGCTGTGAAAAATTAGAGAAAGGTCTAAAGTTACACTTT
GGAGGATACTACAAAATAGAAGACAAACTTCAAGAAAGATTCACTCAATCAATGAAAGAC
TACTAGAAAAAGTCCATAGAACTTGAGATATTCAAGGTGTTTGAGGGTTAAGACGTGAGA
AGTTTGGGAACCAGATTGCAAGAAATGAAGAGACACCTGGAGATGCAGGAAAACAAGGAA
AGTGAATTGCAGCAGAGATTTGCAAGTTTGAGAGCAGAGAGGGAGAGACTGGAGAAAACA
CTTATTTCAATTAAAGATACCAACAAAAAGTGA


>Contig21598.0.g16(protein)
MRYMVKGGIWKNTEDEILKAAVMKYGLTQWSRISSLLVRKSAKECKARWYEWLDPGIKKT
EWTREEEEKLLYLAKIFPTQWRTIAPIIGRTPAQCIEHYEKLLDAAQGKSGEEFDESDPR
RLRPGEIDPNPETKPCKPDPVDMDEDEKEMLQECRARLANTKGKKAKRKAREKQLEEARR
MASTQKQRELKAAGIDVRRPTKIRGVNYNIEIPFEKKVPIGRFDTSEEALQIDQLKQNIA
LQQIEIKRRDEDEKKRRALDAKKLKKLKQKNLPKALELINKNDNAAAMIGINTKLSLPAP
QINDDELDIIKKYAAGNLETMPGMGQADSTATRALMGNYSQRDILQTPAASQMGGKTPLM
SQRIMQEAQNALYYKNSQTPLIGGETPQLNNTGLRAGQDSIHQGQTPSLLAKRQSTGMIG
MQDQDGFIMPAPKRHKQTGIIQPQRLQTPLRDEFKLNQSEDTLMDNQWERSSMISGMTQI
DTSTQQRGEFNITAQLANLSKPRNEFEISAERIIELEEQIARQEQMIWENENEKQKVEDL
EDQKARLKIEKAKLEELERRKQSTVIKQNLPRPNIINQKFFKQIQENQDVVQKMIFEEMQ
AMLINDNHKHPVKGMKEIKQAKYFQEISPEYMEYARQLIQEEAQNGLELYPMFNFNKVWE
NLHQEKAMFFPGTKDFDYLQNRSKAEQIEAVRFEFETATRHLEKEISRCEKLEKGLKLHF
GGYYKIEDKLQERFTQSMKDYQKKSIELEIFKVFEGQDVRSLGTRLQEMKRHLEMQENKE
SELQQRFASLRAERERLEKTLISIKDTNKK