Identifiers and Description

Gene Model Identifier

Contig20999.0.g14

Standard Name

CDC45e

Aliases

Contig20999_0_g14

Description

CDC45-like protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam02724 ) CDC45-like protein
  • ( pfam06213 ) Cobalamin biosynthesis protein CobT
  • ( pfam09204 ) Bacterial self-protective colicin-like immunity

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20999.0.g14(coding)
ATGGTTTCACTTATGAATTTCGAAGAGATCAACGATTAGGCAATAGCGAGAATTAGATTA
GAATATGATAACTACCCTGATAGAAATCCATACTAAAATCTTCCAGAGATTCTCTCAAAT
AAATATAACTAAAATGACAATTTTGTGCAAGATGAAAATCAAAATGAATATCAAGAGTAA
AATGACAGAGAAGACTCAAACGAAGAGCAAAAAATGGGCAATAATTATGAAGCGGATAAT
AATGCAACAGACGATAATTATGAGTAAGATTAAAATGGAATAAAGAAAAAGATTAAATAA
AAGAAAATTGGAAGACCTAAAGTCCCTAAAAATCAGAGACTTACAATGTATTAATATTGA


>Contig20999.0.g14(protein)
MVSLMNFEEINDQAIARIRLEYDNYPDRNPYQNLPEILSNKYNQNDNFVQDENQNEYQEQ
NDREDSNEEQKMGNNYEADNNATDDNYEQDQNGIKKKIKQKKIGRPKVPKNQRLTMYQY