Identifiers and Description

Gene Model Identifier

Contig8461.0.g61

Standard Name

CDC45d

Aliases

Contig8461_0_g61

Description

CDC45-like protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • transferase activity, transferring acyl groups other than amino-acyl groups (IEA) | GO:0016747

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8461.0.g61(coding)
ATGGAAGCGAAATCAGCTACAAAAACTTTTAGACAGGCCGTCTTATTGATATCACTTTCA
TTGGCACTCACGACAGTAATTCTTATGGCAGCTGGTCTCCCAGATTGTCAAACTGCCAAT
CTCTACTTTGCAATGTCGATGATTTTCTTTGTATACTCAGTGGTATTTATAATGATGCTC
CTGCAATTCATCGGCTTAGTATCATGTCTTAAAACTATACCAAGAGCAATTATGGGTTTC
TATTTCTTGCTTGTAGCCATTATGTTCTATGTACAAATGATCTTATTTAAAGGGGATAAC
TGCTCATAAGACTCACCTGTCCTTTTCATTTGGCTTGTAGCTCAAATTGCTCTATTCTAT
TTCATAGTGGCATTTGGCTTAGCAAAATGGGGTTCTTACATTTGCTGGTAGGCTGAAAAT
CACGATTAAATGGCTAAGAGAGCAGTTGATGATTACTTCAAGAAATTAAAATAAAACTAA
CTCATGCTGGAATAAGATGATAAAAACGAACCCTTGTTAAGTAACGAAGGTGAGGAACAT
AAATACTCAGATGAAGATAGCGAATCAGAAGACGAAGAGGACAATCGTAAAAGAAAGCAC
AAAAAGAATAAAATTCACTAAAAGAGTTAGCTCGCCATCGAAAATTGA


>Contig8461.0.g61(protein)
MEAKSATKTFRQAVLLISLSLALTTVILMAAGLPDCQTANLYFAMSMIFFVYSVVFIMML
LQFIGLVSCLKTIPRAIMGFYFLLVAIMFYVQMILFKGDNCSQDSPVLFIWLVAQIALFY
FIVAFGLAKWGSYICWQAENHDQMAKRAVDDYFKKLKQNQLMLEQDDKNEPLLSNEGEEH
KYSDEDSESEDEEDNRKRKHKKNKIHQKSQLAIEN