Identifiers and Description

Gene Model Identifier

Contig18676.0.g12

Standard Name

CDC45c

Aliases

Contig18676_0_g12

Description

CDC45-like protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18676.0.g12(coding)
ATGAATTTAGATACAGATACTCTAGAAAAACAGTACTACGAGCATCAGCAGAAGCTAAAA
AATTAAAATCAAGCTGCAATTATTGAGCAAGACCAAGAATTCGATGATTGCCAGAAAAAA
GTGCAAGAAATTAGGAAGCTGTTAATAAAGTTCAAGCACTCTTAAAAAATCAGAGAGGGG
TCACCAGATTATCATGAATTTTCGAGATTTCTACAGTTAAATGACCAATTACAAACACCC
AAAAATATATGCCTTCACTGTTGGACTTTTGTAAGTTTGCAGCAGACCATGGATCACATC
AATTTGCTGAAGCATACTATTATCTACCAAGATAAATTCTCAGATATAGACAGATTTATC
TAGCTTGCTAGAGATCACGAGAGAATTATAGTTAATGATGATTTAACTCTGACAGTGATT
ACACCACCCTCAACTCCTAAGTCAGTAGATTAAATCAATTAGGAAGCACCTCATAACGGA
CCTACAACTGTTGCTGAATACTTGAATTAAAACAGCAATGTGCTTCATAAGGGAGACAGA
ATGGATGAAGAGCTTAAATTATTCAGACAGCATATTGGAGTAGGTGCAAATACTATGAGA
GACGAAGAATAAAACTCTGCTTTAGGTTCACTTTTGTTGGACGAAAAAGAAGCTCATAAA
TTACCTCCTAACATGCCAAATTTCGATCCTACGTTGGATCTTAATCGCAAAAAGCAATAT
ATTGGCCCACCTTGTCCTCCAGGGCATCCTTATGATCCATTTGGAGAAGATAGAGAATAT
TTCAAAGAAAGGGTTGAGGGAGCTGCATTGTTTGCTCCTCCAGAAGAAAGAGATCCACAT
TTCTTTGAAAATTTTGGTAGAGATGAGAAATTTTACAAGGAAGCTAAAGCTCTGCTCGAT
CTTGGTGAAACTAATGGTAACTTGGAAATGATTAGATTGAACAAGAAATTCGACATTTTC
TTGAAGCGTTTCATGAAAGTTGAGGAAGATATAAAGGAAATCAAGAATAACTTCTTCAGA
GTCATGCATTGTGCTTTTGCTAAGTATGAAGAAGGGTTTAAACGTAAGAACGAATACTTA
GAGAGACGTAGAGTTAGAAAGAGAGAAGAAATTGAGAGAGGAGTTTAAAGAGAACTTGAG
AAGAGAAAGATCGACTAACTTGCTACCGAAGCAGCTGTCATGGACTAGACACCTGAAGTA
AGTGAAGGCGAGGAAGAGGAAGAAGTGGAAGCAGAAAATATGGATGAGAGAAAGTTCATG
AGAAAAATGGAGGTCCAAGATAAACGAGAATAAGAGGCTTACGAAGAGCAGGAGAAACAA
GATCGTGAGAAAAAGCGTCTTAAAGCATAACTCGCAAAGACTAGGCACTTATTAGAACTA
AATGAAAGAGGAGTTCCACTTCCTATTCCTTTGCCAAAGAAAAATAAAAAGAAGGAGAAA
AAGAGAATAAAGAAGGAAAAGAAGAAGCTCAAGGAGCTTAAACTAATGCAAGTTAAGCCA
GTCTTTCCTAACTTACCAGCAAGATCCAGTAGTAGAATAAATAGAAGCGAGGCAAGCAGC
ATGCTTAATAGCGAAATGCCATCATAAGAGAGTCATGCTAGTAAATCTAGCGAATCTAAC
ATTATCAAAACTAATTCTAAGTGA


>Contig18676.0.g12(protein)
MNLDTDTLEKQYYEHQQKLKNQNQAAIIEQDQEFDDCQKKVQEIRKLLIKFKHSQKIREG
SPDYHEFSRFLQLNDQLQTPKNICLHCWTFVSLQQTMDHINLLKHTIIYQDKFSDIDRFI
QLARDHERIIVNDDLTLTVITPPSTPKSVDQINQEAPHNGPTTVAEYLNQNSNVLHKGDR
MDEELKLFRQHIGVGANTMRDEEQNSALGSLLLDEKEAHKLPPNMPNFDPTLDLNRKKQY
IGPPCPPGHPYDPFGEDREYFKERVEGAALFAPPEERDPHFFENFGRDEKFYKEAKALLD
LGETNGNLEMIRLNKKFDIFLKRFMKVEEDIKEIKNNFFRVMHCAFAKYEEGFKRKNEYL
ERRRVRKREEIERGVQRELEKRKIDQLATEAAVMDQTPEVSEGEEEEEVEAENMDERKFM
RKMEVQDKREQEAYEEQEKQDREKKRLKAQLAKTRHLLELNERGVPLPIPLPKKNKKKEK
KRIKKEKKKLKELKLMQVKPVFPNLPARSSSRINRSEASSMLNSEMPSQESHASKSSESN
IIKTNSK