Identifiers and Description

Gene Model Identifier

Contig21726.0.g33

Standard Name

CDC45a

Aliases

Contig21726_0_g33

Description

CDC45-like protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR103C2.000214949834694e-50CDC45 SGDID:S000004093, Chr XI
I from 345941-343989, Gen...
T. thermophilaTTHERM_005848101.000116773704384e-19hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21726.0.g33(coding)
ATGCTTACAACATTATTGAGAGCAGATGAGATGCAGTACATTCAAACTCCAGTATTTTCG
AATTTGCAACTCAGAGATGAAATCTTGAAACTTGAAGCCAATAAAAATATCCGCAGTGTT
TTGTTCATTAATTGTGGAGGCATGCTTGATCACACTAAAATGTGGTACTACAAACCACTT
AACAAAATTGAGCTGTTTATTTTTGATTCCCACAGACCATTCAATCACAACACTCTTATT
GATCCATTGAAGAAGACTTACGTTATTCACGATGGCTGCAAATCATTCGATGAGTACCCA
ACAAAGGAGGATGAGATGATTTATCAGTAACTTCAAAATGAACTTGAAGACTCTGAGGAT
GATGACTATGATTCAGAGGAAGAAAATGAGGACAATTTCGAAGAAGAGGATGAAGTCAAG
GAAGAACTCGAGAATCTTAAGGACTCTGATGATGAGGGAAACACTAAGAAGAAGGGCAAT
AATGATGATGAAGATGATGAGGATGAGGAAGATGATGAAGTTTATGGGGGCACTAAAGTG
AAAAAACCCAAGCATTAATCTCAAGATGATGATGAAGAGGCAGAAGTAGTGGATGCCAAC
TAAATCGATGATGAGGATACTACTGCTCTTAAGCTTGGCCAAAAAAGACCCAGAGACGAA
ACAGGTGCGCTAAAGTTAGTGGATAAGAGAAAGCTAAAGAGACAAAAGAGGCAGAAATTC
AGAAACTACTACAGCGGTCAATTCTTTCACAAGAGTTGCTCTTACCTTATGTACTAGGTG
TGTCAAGCAATGAACAGAGAAAATAAAGATATGCTGTGGTTGTGGATAGTAGGGATGACT
GACCTGAGAGTACACTATAAACACGCTACAGATGGATTGGACGAGGACATGTCACTGTGT
GATGATGAAGTTTAAAGGTTAAATCCTAACATTTACAATAGAGACAATGAAGATGACATT
GATAAGTTCAACGATGATGATGATGAAGAAGAACAAAAGAATAGCAATAGCAACCCCTAG
AATGATAAGGACTTGTTCAAATTGGTTAGTCTGTAATCAAGAAACAAAGAAGTAGGAACT
ATTACAATGGAATAAGAATTAAAACTTATGCTTCTCAGACATTGGAGTTTCTACGAATCA
CTCTTCCATTCTAACTATGTCGTGTCAAAGTTAACTCTTTGGAAAGAACCAGGCAAAAAG
GATCTTAACAGATTCTTGGCTCAACTAGGCATCTCAATAGAAGAAGCTAAGCAAAGTTAC
TAATTTATGGATCCAGTCATAAGAAATGAATTGAAAACTAAGATCCTTGAAAATTGCCAT
ATTTTCGCTCTAGATAACATCATGTAGAAAACTTACATGCTACAGTTGGATCATAAGACT
CAGATTCTCGCCACAGATATGGCTTATAGCGTGACAACAATTTTAGAGAGTCCAAAGAAC
TTGAACATTAAAAATGGCATGCTAGCACCTAGTACCAAGTTACTTGATGAATCAGGAAAG
ATGACTTTTTCAAACTCACTGGATGTTAATAACCTACTTTCCAATAGAATTTCAGGTGTC
ACTCTTAACTAAAGCTCATTACTGCAAAAAGAACTAGAAACCAGAGAACACATAGAATAC
CTGAACTAATGCAAATATGACAATTTCTACGTTGCTCTAGACTCCTTAGACCGCAAAAAT
AAGCACCTGCTTGAGAAGGGTATTGAACTTGCAAAAGACCTATAAAAAGCAATAATTTAA
ATGGGTACATCAATATTGGATAAGAAGCAGGTTAAGCTGGCAACAAGATTTAGATATGCA
TTCTTAGATAATGATCAGTTCAAGGATATTGAGATGTTCCAGTTTCCTCTTGCTCTTTAA
AAACTGGCTCTGTTCTTAATGGAAACTTATCAGCAGTTGAAACCAAGTTCAAAGATGAAG
CCATTCGTGATCTCAGTGAGAAACAACAGAAAAGGCACAACTCTAATATGCGCAGTTCTC
GGCCAGTCAATGGAAGTCGATTACAGAAGAAACAATTTCAGTGACTTATTCAGACAAATC
ATAGAAAGCAAGAACATTAAAGCCAAACATGACGCTTTCGACTCATCAATTATAGAAATT
AGAAATGAAGATTTCAGGCCATTTGTAGAGGAGCTAGTCAACACCAATTGA


>Contig21726.0.g33(protein)
MLTTLLRADEMQYIQTPVFSNLQLRDEILKLEANKNIRSVLFINCGGMLDHTKMWYYKPL
NKIELFIFDSHRPFNHNTLIDPLKKTYVIHDGCKSFDEYPTKEDEMIYQQLQNELEDSED
DDYDSEEENEDNFEEEDEVKEELENLKDSDDEGNTKKKGNNDDEDDEDEEDDEVYGGTKV
KKPKHQSQDDDEEAEVVDANQIDDEDTTALKLGQKRPRDETGALKLVDKRKLKRQKRQKF
RNYYSGQFFHKSCSYLMYQVCQAMNRENKDMLWLWIVGMTDLRVHYKHATDGLDEDMSLC
DDEVQRLNPNIYNRDNEDDIDKFNDDDDEEEQKNSNSNPQNDKDLFKLVSLQSRNKEVGT
ITMEQELKLMLLRHWSFYESLFHSNYVVSKLTLWKEPGKKDLNRFLAQLGISIEEAKQSY
QFMDPVIRNELKTKILENCHIFALDNIMQKTYMLQLDHKTQILATDMAYSVTTILESPKN
LNIKNGMLAPSTKLLDESGKMTFSNSLDVNNLLSNRISGVTLNQSSLLQKELETREHIEY
LNQCKYDNFYVALDSLDRKNKHLLEKGIELAKDLQKAIIQMGTSILDKKQVKLATRFRYA
FLDNDQFKDIEMFQFPLALQKLALFLMETYQQLKPSSKMKPFVISVRNNRKGTTLICAVL
GQSMEVDYRRNNFSDLFRQIIESKNIKAKHDAFDSSIIEIRNEDFRPFVEELVNTN