Identifiers and Description

Gene Model Identifier

Contig4890.0.g108

Standard Name

CDC45

Aliases

Contig4890_0_g108

Description

CDC45-like protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam02724 ) CDC45-like protein
  • ( pfam01562 ) Reprolysin family propeptide
  • ( pfam04695 ) Peroxisomal membrane anchor protein (Pex14p) conserved region
  • ( pfam03348 ) Serine incorporator (Serinc)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4890.0.g108(coding)
ATGCAGACAATTAGATTCAAGAAAGACGTCAAATTAGAAGAAGTAATTTAGTAGAGAAAT
GTGTAGAACGAGAAGGAAGTCATAGACTGCATTTTAAGGCAAATGAAGAATAAAAACCTT
AAATTTACTTAATTTGATAAGGACTCAGTCTTACAGCTTCATCAGCCTCTTACTAAAGAG
GAAGTTGAGGAGACTTATTTCAATAATAAAGCTGAACAAAATTCAATGTACAATGACGAT
AAGAATGATTCAGATAGAGAAGATGATATGCCAAACAACAATACAAATGAAGATAAAGCA
AAGAAAGATTCAAAAAAGCAATAAAAAAAGAATGAAAAGAGCAATAATAGAAGCAGTCCT
TAGTATCAATATTATCATATGAAGTTTCAGTTTCATGATAGAAATATGACTATAGATTTA
CACAAGAAAGATAGAGCATACTTTTCATCATTTAAAACTGTAACAAGAGATAAAAGAGAA
TATGAAGAGAATAAATTGAGATACCAAACTCCTGGTGTAGGAAAATACTATCCAAAATTC
AAAGTTGTAGAGCAATTAATGCCAATAATTTAAATGTCAAAAGCTGAATTAAATAGGACA
AGAAATTTTGTGTCTCCAAATGTCTACAAAGATGCAAAGGATCTCACATACACTCCTTCA
AAAGAAAATCTCATTTAAAAAGAAAAGAGTTAAAATTCAATTAATACTTAACCATCCCCC
AATAAAATCAGAGATGGATGGAATAATGCGCATGGGATGTTGGACTTAAACAAATAATCT
TAGAGGAAGTTTGTTTTTGAAAATTTGATAAGAGTTAATGAGCAAAGATTCAACTATATT
TAGTTGCCTCAAATTTACAGTAAAAATAGAAAAGTGACAGGGGATGCTGACTTTGGGAAG
TCTTCTGCAAGAAGAGGTTTATTTAAATTGCCTGAGCATTAGCCCATGTATTCACCTAAT
TTTGATTTAACAACAAGAAAGAATCCATAATTAGTCAATATGAATGTTAAACTGCTCAAA
GATATGTATCATAATATAGATTGA


>Contig4890.0.g108(protein)
MQTIRFKKDVKLEEVIQQRNVQNEKEVIDCILRQMKNKNLKFTQFDKDSVLQLHQPLTKE
EVEETYFNNKAEQNSMYNDDKNDSDREDDMPNNNTNEDKAKKDSKKQQKKNEKSNNRSSP
QYQYYHMKFQFHDRNMTIDLHKKDRAYFSSFKTVTRDKREYEENKLRYQTPGVGKYYPKF
KVVEQLMPIIQMSKAELNRTRNFVSPNVYKDAKDLTYTPSKENLIQKEKSQNSINTQPSP
NKIRDGWNNAHGMLDLNKQSQRKFVFENLIRVNEQRFNYIQLPQIYSKNRKVTGDADFGK
SSARRGLFKLPEHQPMYSPNFDLTTRKNPQLVNMNVKLLKDMYHNID