Identifiers and Description

Gene Model Identifier

Contig12197.0.g66

Standard Name

CDC27b

Aliases

Contig12197_0_g66

Description

DNA polymerase subunit Cdc27

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12197.0.g66(coding)
ATGTAGAAAAAAGCCGCCATTCCCACATAAAATCTCCAACAAATCACTTCTCTTTTGCAT
AATGGAATTGTAACAATCTATGATGTTATGAGAGAGTTGTGTATTGATTCTATTCAAGCA
AAAAGAGTAATGATGGATTTTGCATTCCAAAAATCCACAAAGTAAAAAGTGATTAAACTT
TTCATAATTGAAAGATAACAATCAGCCTAAAATTCACCAGCTAAGCAATTCTAACTTGTC
TATGAGCATGAACTTGCAAGCATCATTGAGTCTGGTGAGAAAATTGAGAATGCTTATATC
TATGCAGTCTTTGAAGACTCATTTGATATTGATAGTGAACTTTTCAACACAGCTAGATTT
GCACAGTCATTCGATACTTTCAATCAAGTGATTACATTTGAGCCATCACAGAAAGTTAAG
CATTAAAATGCATTGAACAGATAATACCCTAATGGCAGCACAGCTCAAATTACTTCTCAA
ATTAAGCCACCTTCTATCACTGCTAATATTGGAGGAACTCAATAAAAGCAGTAGACCACT
ACTGTTAAATCAACTACTTAAGCTGCTACAGGAGGTCAGTAGAAAGTACAGCAACAACTT
TTCGGAGGAAATTAACAGCAATCAAAGTTAGGCACATCCACTCAATAGAAGCCAGTCGCT
TAACCAGCAGTAGTAAAGCAATAGAAGCCCAAAGAAGTAGTGATGATTGAGGATGACGAG
GAGGAGGTTTACACTTCCACTAATTCTATCAAACCTGCTAAAGCTGACAAACCTATTGGT
GATAAAGTTATGGGAGATCAACCTGTGACCACAACAACTACAGAGACTTAGAAGTAAACT
GGTGATAAATCTTAGGATTCACTTGTCAAGAAGCTTTAAAGCAACAAGCTACATGATAGT
GACGAGGAAGAGACTAAAGCCAACAACAAGAAGAGCACCCAAAACAGCAGTGGCAAGAAG
CGTCTGAACAAGACCAAGGACACTGAGATGCAAGATGAAACTACAGTCAAGAACACCAAA
CCACCAACTACAATGAGTGATGATGAGGATGCCATCCAGAGAACCAACAGAAACAAGAAA
CAACAGCAGAAGAGAGCCACTTTGATGCTGGATGATAGCGATGAAGACGACAATAAGAAC
AACGAGATGGAAGTGTAGTCCAGCAGCATCAAGGAGAACAACACCAATATTGGCAATCTT
ATGAAGGTTAAGATGGGTGCTGTTGTTGTTGACCCCAAAGCTAATGTTAAATCAACAAAG
GAACTCTTAGCTGACACTGTTCCCAAAGGAAAGAGAAAAGTACTGAAAACTAGAATATTC
ACTGATGAGAAAGGCTATGAAGTTATTGAAGACTACGACAGCTATGAGGAGTATGATTTG
CCACCACCAAAGACCACATCTATCGTCAACACCAAGAAACCAGCAGTGACCAAGAATGTG
ATAAACTTAGCAACAAACAACACCAAAGCTCAGACTTAATAAAACGCAGCCACTAAATAA
GCAGTTCCTGACTCTAAAGCCAAAAGTCAACACTCCCTGGCTTCATTCTTCAGCAGAAAG
CAATGA


>Contig12197.0.g66(protein)
MQKKAAIPTQNLQQITSLLHNGIVTIYDVMRELCIDSIQAKRVMMDFAFQKSTKQKVIKL
FIIERQQSAQNSPAKQFQLVYEHELASIIESGEKIENAYIYAVFEDSFDIDSELFNTARF
AQSFDTFNQVITFEPSQKVKHQNALNRQYPNGSTAQITSQIKPPSITANIGGTQQKQQTT
TVKSTTQAATGGQQKVQQQLFGGNQQQSKLGTSTQQKPVAQPAVVKQQKPKEVVMIEDDE
EEVYTSTNSIKPAKADKPIGDKVMGDQPVTTTTTETQKQTGDKSQDSLVKKLQSNKLHDS
DEEETKANNKKSTQNSSGKKRLNKTKDTEMQDETTVKNTKPPTTMSDDEDAIQRTNRNKK
QQQKRATLMLDDSDEDDNKNNEMEVQSSSIKENNTNIGNLMKVKMGAVVVDPKANVKSTK
ELLADTVPKGKRKVLKTRIFTDEKGYEVIEDYDSYEEYDLPPPKTTSIVNTKKPAVTKNV
INLATNNTKAQTQQNAATKQAVPDSKAKSQHSLASFFSRKQ