Identifiers and Description

Gene Model Identifier

Contig17304.0.g24

Standard Name

CDC16

Aliases

Contig17304_0_g24

Description

TPR repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003273405.0017920202841675e-121TPR Domain containing protein
SGDYKL022C2.000704504372864e-47CDC16 SGDID:S000001505, Chr XI
from 397248-394726, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17304.0.g24(coding)
ATGAGTACCCATAAATTCATAGATAGATAGAGAATCGGAGTAGACCAATAGACTCCCCAA
TCGATCGGCAACAACCTAGCAGTTCATAATAACTTGGTGGGAATGCATGGAGGTCCGATG
GGCTTCACTCCATCTGTGCATAAGCAGCCACTTCGAACTGTGGATCACACTCATCATATG
GGAAATAATGAAATGCTTCTTAATGGTAGTTCAGCTATTACTGATGATCAACTCATTCTT
AAGCTTAAGAGGTTAATGAGAATGAACTTAAAGAATTACTGCTACGAGGATGCCATTTTC
TTTGCTGACAAAATGCTACATTTGCAAATGCAACTTACTTGCGGAGCACTTAGTTATGGA
AATGCGAATACAAATGGATTGGGAGCTCAGAGATCTGAGAAGTTTGTGAAGGCAGTTTAT
CATTTGGCAAATTGCTATTTCCTTAACAAAGAATATCTCAGATGTGTCTAACTCATAGAG
AAATTTGAATTGGCCTTCCACAATGAAAAGTTCAGGATCCTCACTGCTCAAGCACTCTAC
AACTCCTAAAATATTAATGCCTGCATCAATGTACTGCAAAAAGATATGGTATAAGAAAAT
GAGATGCTATAAGGTGGTGGAAACATAAGTACTATAAGTTACAGTGAAACTAAAAATCAG
GATAAGGATGAAACGACCACTACTAGAATTGGTTTCAACTCATAGCAAAAAGAAGACTAC
TATAAGAGTTTGAGGTTTTTACTCCTAGCAAAGTCTTATGAATTTTCAGAAAATAAGATG
CAAGCAGTTCAGTTTTACTCTGAGGCACTAAGGTATAACGCTGAACTTTATGAAGCTTTC
AATAGATTAATATCAAACTATCTACTGACTAAGGAAGAGAAAAAAGCATTAGTGGAAGAA
TTAAGATTTAGTCCAGAGAATCTATGGTTAAAAGATTATTACATATCCAGAATAGACTAA
AGTTTGAGATAGGGTGAATAAATCGAGGGTTTCATGATGGTTAAGAGTTAATTATTATAA
AATGCCTCCTTGCACAATCACGTAGGGGATGAGAGTCAAATGAGTCCCAGTAGATTTCCA
CCTACTGAATATTTAGATATTGAAGATCCAAGTGATACTTTGAGAAATCCTAAAAATACC
AGTAATATGGGAAATACTTTTTCACCTCCACTTAATTAGTAGTAGTTACTTTAGAATATC
CAAGGTTAAACCAATAATCCTCAAACAACTCAAGTGCAAGAAATAAGTGTAGTTGAAGTT
TTGAATCACTCTGAAAGTTTTGATTTCAAATAAATCGAAGCCGAGAAATTATTTAATGAG
CAGAATTACCTCAAGGCCTATGAAGTTATAAAGAATGTTGTGGATCAGGATTTCTATTAT
GTGAGTATCGTACCATTATATTGCTCTGTTCTTATTGAACTTAATAAAGTTGGAGAGCTT
TATTATCTAGCACATAAATTAGTTAGTGCTAATCCAGATCTTGCTGTCTCATGGTTTGCT
GTGGGCGCTTACTATTTCCTGATCAAGAAATACGACTTAGCGAGAAAGTATTTTAACAAG
GCAAACCGTTCAGATAAGCATTTCGCTGCATCTTGGATAGCATTCGGTCATTCTTTCGCT
GCTCAAGATGAATCAGATTAAGCTATGGCAGCATATAGAACAGCAGCAAGGCTCTTCCCA
GGTTGTCACTTAGCCTCTTTATTCATTGGTATGGAATATCTGAGAACGAACAACCTCAAA
ACTGCCCTACTTTCTTTTAACGAAGCTAAAAGGATCTGCTATGATAGTGATCCAATGGTT
TTCAATGAAATGGGCGTTGTATACTACAGACAGAAGAATTATGATTAAGCCAGGGAATGT
TTCGCAAATGCTTTAAGTTTGTGCAATGAAAGCAATTCTAAGACTTATGAGACTATTTTA
ATTAATTTGGCTCACTGTCACAGAAAACTCAAGGACATGGACTCAGCAATTGAACTTTAT
GAAAAATGCTTGACACTAAATCCAAAGAGTCCGTCTACTTACACTTCTCTTGGTTATGCC
TATCATTTAAAGGGTGAATATAGATAGGCACTTACATGCTATCATAAAGCTAGTTTCCTC
AAGAATGAAGACCCACTCACAGAAGAATTAGTTCAAAGAGCGCTTCAAGATATTAATGAA
TGCACTATAGAGTAAGCATACTTAGGTGCTGGAAATGAATTAGGCGATCACTCTTAATCA
ATAAATGAAATTGCTATGTGA


>Contig17304.0.g24(protein)
MSTHKFIDRQRIGVDQQTPQSIGNNLAVHNNLVGMHGGPMGFTPSVHKQPLRTVDHTHHM
GNNEMLLNGSSAITDDQLILKLKRLMRMNLKNYCYEDAIFFADKMLHLQMQLTCGALSYG
NANTNGLGAQRSEKFVKAVYHLANCYFLNKEYLRCVQLIEKFELAFHNEKFRILTAQALY
NSQNINACINVLQKDMVQENEMLQGGGNISTISYSETKNQDKDETTTTRIGFNSQQKEDY
YKSLRFLLLAKSYEFSENKMQAVQFYSEALRYNAELYEAFNRLISNYLLTKEEKKALVEE
LRFSPENLWLKDYYISRIDQSLRQGEQIEGFMMVKSQLLQNASLHNHVGDESQMSPSRFP
PTEYLDIEDPSDTLRNPKNTSNMGNTFSPPLNQQQLLQNIQGQTNNPQTTQVQEISVVEV
LNHSESFDFKQIEAEKLFNEQNYLKAYEVIKNVVDQDFYYVSIVPLYCSVLIELNKVGEL
YYLAHKLVSANPDLAVSWFAVGAYYFLIKKYDLARKYFNKANRSDKHFAASWIAFGHSFA
AQDESDQAMAAYRTAARLFPGCHLASLFIGMEYLRTNNLKTALLSFNEAKRICYDSDPMV
FNEMGVVYYRQKNYDQARECFANALSLCNESNSKTYETILINLAHCHRKLKDMDSAIELY
EKCLTLNPKSPSTYTSLGYAYHLKGEYRQALTCYHKASFLKNEDPLTEELVQRALQDINE
CTIEQAYLGAGNELGDHSQSINEIAM