Identifiers and Description

Gene Model Identifier

Contig17429.0.g94

Standard Name

CCRN4L

Aliases

Contig17429_0_g94

Description

Endonuclease/Exonuclease/phosphatase family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam03372 ) Endonuclease/Exonuclease/phosphatase family
  • ( pfam02816 ) Alpha-kinase family
  • ( pfam06114 ) Domain of unknown function (DUF955)
  • ( pfam04768 ) Protein of unknown function (DUF619)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006603002.000769134519826e-18Endonuclease/Exonuclease/phosp
hatase family p...
SGDYAL021C0.0000000400154582995175CCR4 SGDID:S000000019, Chr I f
rom 113359-110846, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17429.0.g94(coding)
ATGTCGTCCTATTTATAATCTGATGAGAAGTACTCGTAAATTATCTAAAGAGCAAAGAAA
ACAATTAATTTAGATTAGGATTACAAACCCCAAAACACCCTGCATGTTTTGAACTGGAAC
ACTTTATGTCAAAGATATACAGACGGGTTTCATGATGAAACTGCCAAATGGGTCACCTGG
GAGCATAGATTCCCCTACATTTAATAATAACTGACTCAAGATGAATACGATATCATTTGC
TTACAAGAAGTTGATATGAACCAGGATTTCACTGATTTCTTAGGATCAAAGGGGTATCAA
GGCTTTATTGGCATGAAAATTGATGGAATTATGGGATGTGCAATATTCTGGAGAGCTTCT
ACAGTTACTGCAGCTCAACATTGTGAAAAAAGAGAATTTAATGGAGTTAATCAAATCTAT
GTCCTTGGTCATTTCATTCACAATTAATCAGGCAAGCATTTTATGGTTGTAAATACTCAT
TTAAAGGCTAAAAAGGAGAATAGAGAATTGAGAATTAAGCAAGCAAATTTCCTTATCAAT
GATTTGGCAACTTTAAATCTTCCAGATGAAGAGTTTACCATTCTGACCGGTGACTTTAAT
GATGATCCTGGTGAAGAGCCAATAAACATAATCAAGACCAAGTTCACTAGTTCATTGGAA
GAGTGCTTCGGAGATGAAAAGAAACACTTTACTACTTTTTATTTCAGAGAAAGTGAAGGG
CATGTAAAGAGAACCATTGATTACATATTTTATCATGGCAAAGATAAAATCAGACCAATT
GGCTACTATGATGTGCCAAATGATGAGGATTTAGACTTAAAAATTTGCTGGCCACATATT
AACTAGCCATCAGATCATATGGCTCTTTCTACATTATTTGAGATATTATGA


>Contig17429.0.g94(protein)
MSSYLQSDEKYSQIIQRAKKTINLDQDYKPQNTLHVLNWNTLCQRYTDGFHDETAKWVTW
EHRFPYIQQQLTQDEYDIICLQEVDMNQDFTDFLGSKGYQGFIGMKIDGIMGCAIFWRAS
TVTAAQHCEKREFNGVNQIYVLGHFIHNQSGKHFMVVNTHLKAKKENRELRIKQANFLIN
DLATLNLPDEEFTILTGDFNDDPGEEPINIIKTKFTSSLEECFGDEKKHFTTFYFRESEG
HVKRTIDYIFYHGKDKIRPIGYYDVPNDEDLDLKICWPHINQPSDHMALSTLFEIL