Identifiers and Description

Gene Model Identifier

Contig415.1.g104

Standard Name

CCDC12

Aliases

Contig415_1_g104

Description

cwf18 pre-mRNA splicing factor

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam08315 ) cwf18 pre-mRNA splicing factor
  • ( pfam03496 ) ADP-ribosyltransferase exoenzyme
  • ( pfam00430 ) ATP synthase B/B' CF(0)
  • ( pfam11812 ) Domain of unknown function (DUF3333)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007352700.00000005999527666938375hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig415.1.g104(coding)
ATGAATGAAAATAATAATGGAATGGAAGTGGATGAATCTCATCAGAAGGTAAAGCTTTTC
CCAAGCAACATTTCAAATCAGTCAAATAGAACAAAGCACAACATCCAAGATGATATAATA
TTCAGAAACTACACACCATTTGATCAGTAATCTTTCCCTAATCGTGAGAATATGGAGCAA
TTCAAATAAGTTGCAAAGTTGGAGCAGATGTATGCCAAGAAAGTCAAAAAGCAAATCAGA
GATTATGTGAAAAGCGAGGAAAACCCCATAAATGGAATGTTGCCTAAAATGGCCAATATT
GACTTGAAGAGAAACTTGCAAACAAAAATGGATAGGTTGAGTATAATGACAGAGAGGTCC
ATTCTTGAGATATTGAAGGATTAAGTGTTAGTTAATGGTGGAAAGGGATAAAACGATGGA
TAATGA


>Contig415.1.g104(protein)
MNENNNGMEVDESHQKVKLFPSNISNQSNRTKHNIQDDIIFRNYTPFDQQSFPNRENMEQ
FKQVAKLEQMYAKKVKKQIRDYVKSEENPINGMLPKMANIDLKRNLQTKMDRLSIMTERS
ILEILKDQVLVNGGKGQNDGQ