Identifiers and Description

Gene Model Identifier

Contig5584.0.g33

Standard Name

CCDB1

Aliases

Contig5584_0_g33

Description

CcdB protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • DNA topoisomerase (ATP-hydrolyzing) inhibitor activity (IEA) | GO:0008657

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5584.0.g33(coding)
ATGTCATAAACAGCATCAGCTGAAAATAACTCCAATAATTACCTGAGTCCCTTGATTCAA
CATCACACTAAGTCATTCTTTAACAATTAGCAAGATCAGCTATAGCCATCTGCTCATAAC
TATCAATCCCAATCAACTAATTATCAGTCTTCTAAGTCTCTTTCAACACCAATGCAGATG
TTGTCTCCCTTGAAAAATAAAGCCATAAATTTCTAGTAAAACCAGTACAATTCATCATCT
TAGAAGGGTTAAAGCATGAACTCAACACCCTTATTGACTTATAAAAATGGGGATTAAAGC
TGCTAATAATCAACGAATCAGAAATCAGCTCATAATATATATGATGAGCAGCAAGTAGAA
GATGTAAAGCATTAAATCAAGGCAATTTATGAAGAGATACAAAAGCTATCAGATAAGAGA
GACAAATATATAGAGAAATATAAGCAAAAATCAATAAAAGCTTCTCAGACAGACAATCTT
ATAAAAAGTGAACTCTAGCTTATAGATGAAAATTTCAAAAAAGCGGAGGTAAAGCATTAA
GCTAAAGTTTCTAAATTAGAGACTTAAAAACTTCAAAAAGTTGAAGAAATTCAATAATCA
ATCAATGAGATTGAAAAGCTGGAACTTTTAAGATAGGATTTCATAAATAAAGCTTAGTAA
CTAGAGCAACTAATGAGGGAAATTCTATCATAAAAAGACATAGAAGGGAACTTCATTTAC
AAAAACAGGCAAATCGAGGATGATAATTCTTCTTTAGAAACTATTGACTAGTAAATAAAC
CAAATAGAGAAAAGTAAAGAGCTAATTATTGAGCATGACATGATGACATACGAAGACGTC
AGCAGTTAATTTTATAGAGTGTAAAATTTACAAGAGACTGTTGAGTGGAAATAGCGAAAG
GTAAAAGGGTTAGAAGACAAAATTATCAAGGGAAACGGTAGCTAAAATGTTATATAAAAA
CTCAAGTCAGACCTTGAATAAGAGATGTAGCTAATCACATAACTCTAACAATAAATCAAT
AGCTTCCAGTAAAATGAAATACCTCACTTGAACTAGCAATATGATTTTATTGGGAGAATG
ATTGAGTCTTAAGATTAAACTATGCTTCAATTATTGAATCAAAAAGAATTGCTACTTAAT
CGACTAAGAGGTTTATACAAGCAAAATGATATAGAGTAAAGTCAACCCTCAAACAATGTT
GATGAAGACATAAGAAGAGTCTCCCTTTTAAACGTCAATAAACAACAATTTTTATTCAAA
GTAACCGAGACTGAAGTCAAGATTCAAGCTATTAAAGAAAAAACAGAGGAATTATATGCG
GAAAATTTATTAATTGATTAATAAAAGGAGCATGTTTCAGATGAGTATAAATAAGAATTG
TTTTAAATTACTGAAAAATAGATGCAGCTTTATAAATTCAAGGAATAATTTGAGAGTAAA
ATTAAGCCTTCTTTAGTTAAAATGGACTCAAAGATAAATAAAGTTGGAGAGATTATTTTA
TCAAAGAAAAACGAATTACTGCAAATATAAAGGTAGTTAAATACTGGAATGCAGAGAAAA
GACTATTAAATGATTTCAAGTTTAAGTTAACTTTAATTGAATGGAACTTGCAATTAGTAT
ATAAACGAAGAAGTTTTAAATAAAGATGAAATGACTATGGAGTAAATCTAGCAAGCAGAA
CTTAACTTGCTTGAAAATATTGCAAAATTCTAAACTCAAAGACCTTCTAATGATTACATT
CATCAATCAAGTATACATTAATTTGACCGCCAAGCTGAATAAACTGAGATTTCAACTCCT
TTCAAGGAACTTCATTAAAATTAAGTTTCCCTCTCCTTAAGACCTTAGTCTAGGTTGACA
GCTTTTAACAATCCAGATTTCTTATACAGAATTAAACCTTTACTTTAAGGTGTTGAAATA
TACAAAAAGACCTTCAATACAAAGCTTCTGACTTCCTTAAGTGCTCCTTAGAGATACAAT
ATTTTAACTGATAATAAGAGAGTCACTCCAGAGTTAGTTGGCTACTAATTAAGAATGATA
AAATTACAGTAGGATGATATTATGAAACTGGAATTTATCAATGCTCATGAACCTAATCAC
ATAAATGAAAGTGATGTTATAGACCTTTAAAAGACTAGATTAGTTGTGCCAAAGGATACT
TTGGATTCTTTGAAAGAGCAAAGAAAAGACAAAAATCCTGTTCATTAAGTGCAAGAGAAG
TATTTTACTGCATTTGATAGATCAATATGCTCTCAAGATTCCTAAAATCTAAGAAAAGAA
AACACCTTTATCAGAGAACAAAAGCTTCAATATAATGAAAAATGCAAGCATGTGCAATAC
TTCAGTTTGATGCTAGTTTATGATGATAAGGAAGTAGATGTGTTGGTGTCAAATGCAGGT
GGGCATTACAATTTTATGATTGTCAAAGATGCTATTGAAAGCTTGATTTAATCAAAGAAG
GGCTAAATTAACAAACTTTAGAAAGAAATCAAAAATAAATAACAATGA


>Contig5584.0.g33(protein)
MSQTASAENNSNNYLSPLIQHHTKSFFNNQQDQLQPSAHNYQSQSTNYQSSKSLSTPMQM
LSPLKNKAINFQQNQYNSSSQKGQSMNSTPLLTYKNGDQSCQQSTNQKSAHNIYDEQQVE
DVKHQIKAIYEEIQKLSDKRDKYIEKYKQKSIKASQTDNLIKSELQLIDENFKKAEVKHQ
AKVSKLETQKLQKVEEIQQSINEIEKLELLRQDFINKAQQLEQLMREILSQKDIEGNFIY
KNRQIEDDNSSLETIDQQINQIEKSKELIIEHDMMTYEDVSSQFYRVQNLQETVEWKQRK
VKGLEDKIIKGNGSQNVIQKLKSDLEQEMQLITQLQQQINSFQQNEIPHLNQQYDFIGRM
IESQDQTMLQLLNQKELLLNRLRGLYKQNDIEQSQPSNNVDEDIRRVSLLNVNKQQFLFK
VTETEVKIQAIKEKTEELYAENLLIDQQKEHVSDEYKQELFQITEKQMQLYKFKEQFESK
IKPSLVKMDSKINKVGEIILSKKNELLQIQRQLNTGMQRKDYQMISSLSQLQLNGTCNQY
INEEVLNKDEMTMEQIQQAELNLLENIAKFQTQRPSNDYIHQSSIHQFDRQAEQTEISTP
FKELHQNQVSLSLRPQSRLTAFNNPDFLYRIKPLLQGVEIYKKTFNTKLLTSLSAPQRYN
ILTDNKRVTPELVGYQLRMIKLQQDDIMKLEFINAHEPNHINESDVIDLQKTRLVVPKDT
LDSLKEQRKDKNPVHQVQEKYFTAFDRSICSQDSQNLRKENTFIREQKLQYNEKCKHVQY
FSLMLVYDDKEVDVLVSNAGGHYNFMIVKDAIESLIQSKKGQINKLQKEIKNKQQ