Identifiers and Description

Gene Model Identifier

Contig15376.0.g47

Standard Name

CBP80

Aliases

Contig15376_0_g47

Description

MIF4G like

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15376.0.g47(coding)
ATGATTGTGAGAGTGGGTGATGAGAGAAGGCACTTGAGAGATGAACATCTAAGGAAACTC
AAAGACTTCCTTTTGCTAGAACAAACTCAATCAAACTACAGAGAGTTAGCTATTGACACC
CTGCAAAAGTGTATAAAGAACTTACCTCATAAAGTCATGTTGTATGCTGCACTAGTCACC
TTGATCAACAACTCAAATGCAGAAGGACATGAAATGATTTAAGATTTAATCGAAAGATTA
ATCTCTGATATTCCTGAATCAATATTGATGAGCAGTCAAAAAGCAGACTCAGCCAGTAAT
CTTGACATTCACGCTAAAAGCATCATGAGATTTATTGGTGCTGCTACTGAATATGGATTG
ATCAACCCTTCTTTGACACTTAAGATTATTTAAGAAATTTTCAACTTTGTGGTGAAATAA
GATATCAAGAGTGATTTAGTGTTGGAGAGTTTGCTATTTTGCATTTAACTTGCTGCTTCT
CAATTAAATCAGATAGCTGAGTTCAATGACTTGATTGCATCATTGAAAGGGTTATTTGAA
AAGAGATCAAATCTCTAACTGTAAAGAAGAAAAGCTTTATTTTCAAATAATAACCTTGAA
CGCTTGCATGACATTCAAAATTTAGATCACTTAACTTAACAATGGCATCATTTCTAACAA
AATCCTGATAAGAAAATCCAACAAAGCAGAGTTTTATTATCTGTCTCAGATGAATTCTAG
AATGAGCTGAAGACTAACAATAAAGCCATCTCTAGTTTTAAAGCAGAGATGAATTTCAGT
AAAGTCTTATAAGAATCAACAATTGAATATCGCCATGTCAACAATAAGATAACTGAAAAT
TCGCAATTACACGGTTATTTTTCAACCTATCCTTAAAATCCTCTTAATCTTAAACTTGAC
AATTCATTAGAACGTGCAATCTTTGAAGACTTAATTGGAATGATTTTGTAATCTTTTGCA
GATTCCCAGGAAATGGCTTCTCACAACTTATGGTCAACTTACATTCATGATGATTTGAAA
AACAGCCAACCACAGTTAATTCTCAATACAATCTTTACAAGATTACTACACTTGCCAAAT
TCACACAGAAATCCCATTTTCTATGCTTCAGTTTCCATATCAGTTGCTAACCAGACTAAA
GATTAAGAAAGCTTCAAGAATTTCAAATAAATGATTGAAGATTCAATAGCATATTACTTC
AAAGATTTTTCAAGTTATGACATAGACATCCAGAACAGACTGATAGAATATACCAGTTTT
TATATCAGTCAGCATGACTTCAAGTTTGATTCTCTTCTTGAGAAATTTGAGAGCAAGGAA
GTTGATGAGCAACTTTTCAAGAGACTTTTGATTTCAGTTGTTCGTATGTCTTACATCAAG
AAGATATAGTCTTCTATTGATGAGAAATATCATGGATATTTGCCAGAGGATAGAGAGTTC
TAAGAACCCAAACTGATGTATTGCACCGAATAGTAGGATAGCCCTGATGCTCAAATCATT
CTAGACTTACTAAATCAAAAGGAGACACCTGAAAACTTAAAAGCTGCATTGGCTGGAGAG
AATTCAAAGATTGAGGCAAGTGGAGAACAAATGAAGGAAATCTTTTTAGAATGCATAATT
TCAAAAACAAAGAAAAGTTTAGAGCATCTCAAAAGAGTATTTGAGCATTATTACCAGCAT
ATTATGCAGCCATTCTTCCTTGGAGACACAATTGCAGAAAGTTAAGTGACTTTAATTAGA
ACAATTTGCAATATCTGGATCAACAACCCAAAGAAGAATCTTCAAATCATTGAGAAACTC
TACTCTCTTGGAATTATTGTGCCAAAGTATGCTTTAGTATATTCCTTCCAAGCTTTAAAT
GATCTTTCAGTTAAAGAGCAGCAATCTAATGAGAATATTCACTCTTAGATAATTTCACTT
TTAGTGAAATCTGTGAGTCACAGACCAAGCCAGTTGTTCACTCTCTACAACTAGAAAGAT
AACCCTATCTCTCAAAGGGAGAAAGATAGACAGGCACTTGAAGGGGAAGGAAATGCTGCT
AATGCTCATCCTGCTCATTTCGATTTATCCTTGTCCAAAAGATTGGTGATCAAGAATGAC
GCAGACTTTGAAAATCAACACAAGCTTGCTTGCTAAGAGAGGGATGAAGTTATCAAGATG
ACTACTCAAAGCTACTTGAAACTCATCAATGAGAACTAGAATGGTTTGAAAGAACTACAG
AGTTAATTTGCTAGACTTCTGAGAGGTTACATTCATTCATTTAGTGGTCCTGCAATCATC
GAAGCTGTCACTCAAATGGAGATCCAGAATGAAATTGCAAAGGAGACAGTTGAGATCATT
AGATCATTGTGA


>Contig15376.0.g47(protein)
MIVRVGDERRHLRDEHLRKLKDFLLLEQTQSNYRELAIDTLQKCIKNLPHKVMLYAALVT
LINNSNAEGHEMIQDLIERLISDIPESILMSSQKADSASNLDIHAKSIMRFIGAATEYGL
INPSLTLKIIQEIFNFVVKQDIKSDLVLESLLFCIQLAASQLNQIAEFNDLIASLKGLFE
KRSNLQLQRRKALFSNNNLERLHDIQNLDHLTQQWHHFQQNPDKKIQQSRVLLSVSDEFQ
NELKTNNKAISSFKAEMNFSKVLQESTIEYRHVNNKITENSQLHGYFSTYPQNPLNLKLD
NSLERAIFEDLIGMILQSFADSQEMASHNLWSTYIHDDLKNSQPQLILNTIFTRLLHLPN
SHRNPIFYASVSISVANQTKDQESFKNFKQMIEDSIAYYFKDFSSYDIDIQNRLIEYTSF
YISQHDFKFDSLLEKFESKEVDEQLFKRLLISVVRMSYIKKIQSSIDEKYHGYLPEDREF
QEPKLMYCTEQQDSPDAQIILDLLNQKETPENLKAALAGENSKIEASGEQMKEIFLECII
SKTKKSLEHLKRVFEHYYQHIMQPFFLGDTIAESQVTLIRTICNIWINNPKKNLQIIEKL
YSLGIIVPKYALVYSFQALNDLSVKEQQSNENIHSQIISLLVKSVSHRPSQLFTLYNQKD
NPISQREKDRQALEGEGNAANAHPAHFDLSLSKRLVIKNDADFENQHKLACQERDEVIKM
TTQSYLKLINENQNGLKELQSQFARLLRGYIHSFSGPAIIEAVTQMEIQNEIAKETVEII
RSL