Identifiers and Description

Gene Model Identifier

Contig3027.0.g26

Standard Name

CBP20b

Aliases

Contig3027_0_g26

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004717302.0003218023735366e-33nuclear cap binding protein
SGDYPL178W9.997975313387782e-28CBC2 SGDID:S000006099, Chr XVI
from 212158-212784, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3027.0.g26(coding)
ATGGCCTATACTTTATACACAATAATCTAGCAAGACCCAGACAAGACTTATTATGATAGA
AAGTAGGGTCTTACGCAGGAAGAATACTTTTAGAAAATAAAAACAAGTACTACACTTTAC
GTGGGAAATCTCTCGTTTTATACCCGTGAAGATCAGCTTTTGAACTATTTTTCACTCTGC
TCTTAAATATTGCCCCGTTTGATAATGGGGTTGAATAATTAAACTAAGACTCCATGTGGT
TTTTGCTTCGTTGAATATGCCACTAAGCAGGAAGCTTCACTGGCAAGAGCACTCTTAGAT
CACTCAAATATCGATGGAAGAATTGTAAGAGTAGACTGGGATGTGGGCTTTGAATGGGGG
AGACAATACGGCCGGGGCAAAAATGGCTACTAAATTAGGGATGAATTAAGACCTGAAGAT
GTCAAAGATCATGAAAGACCTAAGAACATGCATAATAGGGAGAGAAGACCATATATCAAT
AGAAACGGAGAATAGGATAAAGATAATGAAGGTGAGAATGGAGATGCTTTCAGAAGACGT
GGTGGTAGGGGTGATTTCAGAGGAGAGCGTGGTCGATTTAGAGGTGGTGATAGAGGTGGC
CGTGGGGGGTTCAGAGGAGGCAGAGGAAGAGGTGGATATAGAGACAATAATGATGATGAC
AATAACGATTCAAGTTGTAAAGCCAATAATGACGCTTTTGATTAATGGAACAACATAGAC
ACTGCCAACTAAAATGATACTGACAAGAAAGATGATCCTTGGGCTAAAACTGAAGATAAT
TGGGCTAATACTGATCAGAAAATTGAAACAAAAAATGAAACTATGACTGACAGTGGATGG
GGTAGTGACAAGGAAAATAAGAATGATAATAGTAAAAATAAGTAATGGGGTGATGACGAT
AATAAAGTAAAGTCTAGTGATGATTGGGGAGGTAAAAGTGAAAGTAATAATAACAACAAC
AATAATGATAGACCATTTTAGAGTAGATATGATAGATAAAATAGCAACAATAGAAACGAT
GATTATAGATAGAATGACAGGGAAGATTCTGGTGGTTACAGGGGTAGCAGAGGAAATTAC
AGAGGTGATAGAGGAAACTACAGAGGTGGCAGAGGAGAATACAGCAGAGGCAGAGGAGAT
TATAGAGGTGGAAGAGGTGGGTATAGAGGAAGCAGCAATGATTACAATAGAAATTCTGAT
TATAGTAATAGCAATTATCAGGGAGACAGGAAAAGATTTAAAAGTGATCAAGACAATAAT
AATACAACTAGTGATGATTGGGACAAACCAACAAACTAAGCCAACATAAATGCAAATTCC
CCTATTTAAGGTGATAAGAAAAGCACTAAAACTCCAAATAAAGACATTGATTAGTGGGGA
GATACAAGTGAAATTAAAGTTGGCACGAAAAGAAAGCGAGAAGTTAACAACGATGAAGAT
GGTTGGGGAGATGATAATAAGAAAGAAAGTAAAGATGAAAGTAATAATGGATGGGGAGAT
GATAGCAAAAGCAAAGATGAGTTAGTAAACAAATAGAATGATGTAAACAATAATGATGGA
GGATGGGGTGATGTACCCAGTAAAGTTAATGTTAAAAATGAACTAGCTGATGATACTGAA
TGGTGA


>Contig3027.0.g26(protein)
MAYTLYTIIQQDPDKTYYDRKQGLTQEEYFQKIKTSTTLYVGNLSFYTREDQLLNYFSLC
SQILPRLIMGLNNQTKTPCGFCFVEYATKQEASLARALLDHSNIDGRIVRVDWDVGFEWG
RQYGRGKNGYQIRDELRPEDVKDHERPKNMHNRERRPYINRNGEQDKDNEGENGDAFRRR
GGRGDFRGERGRFRGGDRGGRGGFRGGRGRGGYRDNNDDDNNDSSCKANNDAFDQWNNID
TANQNDTDKKDDPWAKTEDNWANTDQKIETKNETMTDSGWGSDKENKNDNSKNKQWGDDD
NKVKSSDDWGGKSESNNNNNNNDRPFQSRYDRQNSNNRNDDYRQNDREDSGGYRGSRGNY
RGDRGNYRGGRGEYSRGRGDYRGGRGGYRGSSNDYNRNSDYSNSNYQGDRKRFKSDQDNN
NTTSDDWDKPTNQANINANSPIQGDKKSTKTPNKDIDQWGDTSEIKVGTKRKREVNNDED
GWGDDNKKESKDESNNGWGDDSKSKDELVNKQNDVNNNDGGWGDVPSKVNVKNELADDTE
W